KEGG   Loxodonta africana (African savanna elephant): 100668323
Entry
100668323         CDS       T04351                                 

Gene name
KCNJ3
Definition
(RefSeq) LOW QUALITY PROTEIN: G protein-activated inward rectifier potassium channel 1
  KO
K04997  potassium inwardly-rectifying channel subfamily J member 3
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04713  Circadian entrainment
lav04723  Retrograde endocannabinoid signaling
lav04724  Glutamatergic synapse
lav04725  Cholinergic synapse
lav04726  Serotonergic synapse
lav04728  Dopaminergic synapse
lav04915  Estrogen signaling pathway
lav04921  Oxytocin signaling pathway
lav04929  GnRH secretion
lav05032  Morphine addiction
Brite
KEGG Orthology (KO) [BR:lav00001]
 09150 Organismal Systems
  09152 Endocrine system
   04929 GnRH secretion
    100668323 (KCNJ3)
   04915 Estrogen signaling pathway
    100668323 (KCNJ3)
   04921 Oxytocin signaling pathway
    100668323 (KCNJ3)
  09156 Nervous system
   04724 Glutamatergic synapse
    100668323 (KCNJ3)
   04725 Cholinergic synapse
    100668323 (KCNJ3)
   04728 Dopaminergic synapse
    100668323 (KCNJ3)
   04726 Serotonergic synapse
    100668323 (KCNJ3)
   04723 Retrograde endocannabinoid signaling
    100668323 (KCNJ3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100668323 (KCNJ3)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    100668323 (KCNJ3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:lav04040]
    100668323 (KCNJ3)
Ion channels [BR:lav04040]
 Voltage-gated cation channels
  Potassium channel, inwardly-rectifying (Kir)
   100668323 (KCNJ3)
SSDB
Motif
Pfam: IRK_C IRK
Other DBs
NCBI-GeneID: 100668323
NCBI-ProteinID: XP_003406060
LinkDB
Position
Unknown
AA seq 536 aa
MPVVGEEKRSLEKLRARSAPARFASRLNLARPYVLCLHLRRKFGDDYQVVTTSSSGSXLA
AQGPGQGPQQQLVPKKKRQRFVDKNGRCNVQHGNLGSETSRYXSDLFTTLVDLKWRWNLF
IFILTYTVAWLFMASMWWVIAYSRGDLNKAHVGNYTPCVANVYNFPSAFLFFIETEATIG
YGYRYITDKCPEGIILFLFQSILGSIVDAFLIGCMFIKMSQPKKRAETLMFSEHAVISMR
DGKLTLMFRVGNLRNSHMVSAQIRCKLLKSRQTPEGEFLPLDQLELDVGFSTGADQLFLV
SPLTICHVIDAKSPFYDLSQRSMQSEQFEIVVILEGIVETTGMTCQARTSYTEDEVLWGH
RFFPVISLEEGFFKVDYSQFHATFEVPTPPYSVKEQEEMLLMSSPLIAPAITNSKERHNS
VECLDGLDDISTKFPSKLQKITGREDFPKKLLRMSSTTSEKAYSLGDLPMKLQRISSVPG
NSEEKLVSKTTKMLSDPMSQSVADLPPKLQKMAGGVARMEGNLPAKLRKMNSDRFT
NT seq 1611 nt   +upstreamnt  +downstreamnt
atgccagtggtgggggaagagaagagaagcctcgaaaagcttcgagcgcgctcggctcct
gcgcgctttgcttcgcgtttgaatctggctcgcccctacgtattatgtctgcacctccga
aggaaatttggggacgattaccaggtagtgacaacctcgtcaagcgggtcgnngcttgca
gcccaggggccgggccagggcccgcagcagcagcttgtgccgaagaagaagcggcagcgg
ttcgtggacaagaacggccggtgcaatgtacagcacggtaacctgggcagcgagactagc
cgctacntttcggacctcttcaccaccctggtggacctcaagtggcgctggaacctcttc
atcttcatcctcacctacacggtggcctggctcttcatggcgtccatgtggtgggtgatc
gcctactcccggggcgacctgaacaaagcccacgtaggtaactacacgccctgtgtggct
aatgtctacaacttcccctctgccttcctcttcttcatcgagaccgaggccaccatcggc
tatggctaccgctacatcaccgacaagtgccctgaaggcatcatcctcttcctcttccag
tccatcttgggctccatcgtggacgccttcctcatcggctgcatgttcatcaagatgtcc
cagcccaagaagcgcgccgagacgctcatgttcagcgagcacgcggtgatctccatgagg
gacggcaaactcacgctcatgttccgggtgggcaacctgcgcaacagccacatggtctcc
gcgcaaatccgctgcaagctgctcaaatctcggcagacacctgagggtgagttcctaccc
cttgaccaacttgaactggatgtaggttttagtacaggggcagatcaactttttcttgtt
tcccccctcacgatttgccacgtgatcgatgccaaaagccccttttatgacctatcccag
cgaagcatgcaaagcgaacaattcgagattgtcgtcatcctagaaggcattgtggaaaca
actgggatgacttgtcaagctcgaacatcatacactgaagatgaagttctttggggtcat
cgcttttttcctgtaatttccttagaggaaggattctttaaagttgattactcccaattc
catgcaacatttgaagtccccaccccaccttacagtgtgaaagaacaggaggaaatgctc
ctcatgtcgtcccctttaatagcaccagccataactaacagcaaagaaagacataattct
gtggaatgcttagatgggctagatgacattagtacgaagtttccatctaagttgcagaaa
attactggaagagaagactttccaaaaaaactcttgagaatgagttctacaacttcagag
aaagcctacagcttgggagatttgcccatgaaactgcaacggataagttcagttcctggc
aactcagaagaaaaactggtatctaaaaccaccaagatgttatctgatcccatgagccag
tctgtggctgatttgccaccaaagcttcaaaagatggctggaggagtagccaggatggaa
gggaatctcccagccaaattaagaaaaatgaactctgatcgattcacataa

DBGET integrated database retrieval system