KEGG   Loxodonta africana (African savanna elephant): 100668360
Entry
100668360         CDS       T04351                                 

Gene name
NRG1
Definition
(RefSeq) pro-neuregulin-1, membrane-bound isoform isoform X1
  KO
K05455  neuregulin 1
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav01521  EGFR tyrosine kinase inhibitor resistance
lav04012  ErbB signaling pathway
lav05014  Amyotrophic lateral sclerosis
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100668360 (NRG1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    100668360 (NRG1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100668360 (NRG1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:lav04052]
    100668360 (NRG1)
   00536 Glycosaminoglycan binding proteins [BR:lav00536]
    100668360 (NRG1)
Cytokines and growth factors [BR:lav04052]
 Growth factors
  Growth factors (RTK binding)
   100668360 (NRG1)
Glycosaminoglycan binding proteins [BR:lav00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   100668360 (NRG1)
SSDB
Motif
Pfam: Neuregulin EGF hEGF EGF_2 Cyt_b-c1_8
Other DBs
NCBI-GeneID: 100668360
NCBI-ProteinID: XP_010590765
LinkDB
Position
Unknown
AA seq 695 aa
MEIYSPDMSEGAAERSSSPSTQLSPDPSLDGLPAAEDMPETQTADGRTPGLVGLAAPCCV
CLEAERLRGCLNSEKICIVPILACLVSLCLCIAGLKWVFVDKIFEYDSPTHLDPGGLGQD
PIISLDPTAASAVWVSSEAYTSPVPRARSETEVEVTVQGTSAVVSSEPSAAPTPKNRIFT
FSFLPSTAPSLSPPTRNPEVRTPKSAVHPQTTETNLQTAPKLSTSTSTTGTSHLVKCAEK
EKTFCVNGGECFMVKDLSNPSRYLCKCQPGFTGARCTENVPMKVQNQEKAEELYQKRVLT
ITGICIALLVVGIMCVVAYCKTKKQRKKLHDRLRQSLRSERNNMVNMANGPHHPNPPPEN
VQLVNQYVSKNVISSEHIVEREAETSFSTSHYTSTAHHSTTVTQTPSHSWSNGHTESIIS
ESHSVLMMSSVENSRHSSPAGGPRGRLNGMGGPREYNSFLRHARETPDYYRDSPHSERYV
SAMTTPARMSPVDFHTPSSPKSPPSEMSPPVSSMTVSMPSMAISPFVEEERPLLLVTPPR
PREKKYDHHPQQFNSFHHNPAHESNSLPPSPLRIVEDEEYETTQEYEPAQEPVKKLANSR
RAKRTKPNGHIANRLEMDGNTNSESSNSESETEDERVGEDTPFLGIQNPLAASLEAAPAF
RLAECRTNPAGRFSTQEELQARLSSVIANQDPIAV
NT seq 2088 nt   +upstreamnt  +downstreamnt
atggagatttattccccagacatgtctgagggagctgctgagaggtcctccagcccctcc
actcagctgagtccagacccatctcttgacgggcttccggcagcagaagacatgccagag
acccagactgcagatgggagaacccccggactcgtgggcctggcagctccctgctgtgtg
tgcctggaagcggagcgtctgagaggttgcctcaactcagagaaaatctgcattgtccct
attctggcttgccttgtcagcctctgcctctgcattgctggcctcaagtgggtatttgtg
gacaagatatttgagtatgactctcctactcaccttgaccctgggggcttaggccaggac
cctattatttctctggatccaactgctgcctcagctgtgtgggtatcctctgaggcatac
acttcacctgtccctagggctcgatccgaaactgaggttgaggttacagtacaaggtacc
agtgctgtcgtgtcctctgaaccttcagctgcaccaaccccgaagaatcgtatttttacc
ttttctttcctgccgtccactgcaccatccctctctccacctactcggaaccctgaggtg
agaacacccaagtcagcagttcatccacaaacaacagaaactaatctccaaactgctcct
aaactttctacgtctacatctacgactgggacgagccatcttgtaaaatgtgcagagaag
gagaaaaccttctgtgtgaacggaggcgagtgcttcatggtgaaagacctctcaaacccc
tcaagatacttgtgcaagtgccaacctggattcactggagcaagatgtactgagaatgtg
cccatgaaagtccaaaaccaagaaaaagctgaggagctctaccagaagagggtcctgacc
ataaccggcatctgcatcgccctgcttgtggttggcatcatgtgtgtggtggcctactgc
aaaaccaagaaacaacggaaaaagcttcatgaccggctccggcagagtcttcgctctgag
cgaaacaacatggtgaacatggcaaacgggcctcaccatcctaacccacctcccgagaac
gttcagctggtaaatcagtacgtgtctaaaaatgtcatctccagtgagcatattgttgag
agagaagcagagacgtctttttccaccagccactacacctcgacagctcatcattccact
acggtcacccagactcctagtcacagctggagcaatggacacactgagagcattatttcg
gaaagtcactctgtacttatgatgtcatcggtagaaaacagtaggcacagcagcccagct
gggggcccaagaggacggctcaatggcatgggaggccctcgagagtataacagcttcctc
aggcatgccagagaaacccctgactactaccgagactctcctcatagtgaaaggtatgtg
tcagcaatgaccaccccggctcgtatgtcacctgtagatttccacacgccaagctccccc
aaatcacccccttcggaaatgtctccacctgtgtccagcatgacggtctccatgccctcc
atggcaatcagccccttcgtggaagaagagagacccctactgctggtgacaccaccacgg
ccacgggagaagaagtatgaccaccaccctcagcaattcaactctttccaccacaacccc
gcgcatgagagtaacagcctcccccctagccccttgaggatagtggaggatgaggagtat
gaaaccacccaagagtacgagccagctcaagagcctgttaagaaactcgccaatagccgg
cgggccaaaagaaccaagcccaatggccacattgccaacaggttggaaatggacggcaac
acaaactctgagagcagtaactctgagagtgaaacagaagatgaaagagtaggtgaagat
acacctttcctgggcatacagaaccccctggcagctagtctcgaggcagcccctgccttc
cgcctggctgagtgcaggactaacccagcaggccgcttctctacacaggaagaattgcag
gccaggctgtctagtgtaattgctaaccaagaccctattgctgtataa

DBGET integrated database retrieval system