KEGG   Loxodonta africana (African savanna elephant): 100668387
Entry
100668387         CDS       T04351                                 

Gene name
BAD
Definition
(RefSeq) bcl2-associated agonist of cell death
  KO
K02158  Bcl-2-antagonist of cell death
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav01521  EGFR tyrosine kinase inhibitor resistance
lav01522  Endocrine resistance
lav01524  Platinum drug resistance
lav04012  ErbB signaling pathway
lav04014  Ras signaling pathway
lav04022  cGMP-PKG signaling pathway
lav04024  cAMP signaling pathway
lav04062  Chemokine signaling pathway
lav04140  Autophagy - animal
lav04151  PI3K-Akt signaling pathway
lav04210  Apoptosis
lav04370  VEGF signaling pathway
lav04510  Focal adhesion
lav04722  Neurotrophin signaling pathway
lav04910  Insulin signaling pathway
lav04919  Thyroid hormone signaling pathway
lav05010  Alzheimer disease
lav05014  Amyotrophic lateral sclerosis
lav05020  Prion disease
lav05022  Pathways of neurodegeneration - multiple diseases
lav05145  Toxoplasmosis
lav05152  Tuberculosis
lav05160  Hepatitis C
lav05161  Hepatitis B
lav05162  Measles
lav05165  Human papillomavirus infection
lav05168  Herpes simplex virus 1 infection
lav05170  Human immunodeficiency virus 1 infection
lav05200  Pathways in cancer
lav05203  Viral carcinogenesis
lav05210  Colorectal cancer
lav05211  Renal cell carcinoma
lav05212  Pancreatic cancer
lav05213  Endometrial cancer
lav05215  Prostate cancer
lav05218  Melanoma
lav05220  Chronic myeloid leukemia
lav05221  Acute myeloid leukemia
lav05223  Non-small cell lung cancer
lav05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100668387 (BAD)
   04014 Ras signaling pathway
    100668387 (BAD)
   04370 VEGF signaling pathway
    100668387 (BAD)
   04024 cAMP signaling pathway
    100668387 (BAD)
   04022 cGMP-PKG signaling pathway
    100668387 (BAD)
   04151 PI3K-Akt signaling pathway
    100668387 (BAD)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100668387 (BAD)
  09143 Cell growth and death
   04210 Apoptosis
    100668387 (BAD)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100668387 (BAD)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    100668387 (BAD)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100668387 (BAD)
   04919 Thyroid hormone signaling pathway
    100668387 (BAD)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100668387 (BAD)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100668387 (BAD)
   05203 Viral carcinogenesis
    100668387 (BAD)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100668387 (BAD)
   05212 Pancreatic cancer
    100668387 (BAD)
   05225 Hepatocellular carcinoma
    100668387 (BAD)
   05221 Acute myeloid leukemia
    100668387 (BAD)
   05220 Chronic myeloid leukemia
    100668387 (BAD)
   05218 Melanoma
    100668387 (BAD)
   05211 Renal cell carcinoma
    100668387 (BAD)
   05215 Prostate cancer
    100668387 (BAD)
   05213 Endometrial cancer
    100668387 (BAD)
   05223 Non-small cell lung cancer
    100668387 (BAD)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100668387 (BAD)
   05014 Amyotrophic lateral sclerosis
    100668387 (BAD)
   05020 Prion disease
    100668387 (BAD)
   05022 Pathways of neurodegeneration - multiple diseases
    100668387 (BAD)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100668387 (BAD)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100668387 (BAD)
   05161 Hepatitis B
    100668387 (BAD)
   05160 Hepatitis C
    100668387 (BAD)
   05162 Measles
    100668387 (BAD)
   05168 Herpes simplex virus 1 infection
    100668387 (BAD)
   05165 Human papillomavirus infection
    100668387 (BAD)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100668387 (BAD)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100668387 (BAD)
   01524 Platinum drug resistance
    100668387 (BAD)
   01522 Endocrine resistance
    100668387 (BAD)
SSDB
Motif
Pfam: Bcl-2_BAD Bclx_interact
Other DBs
NCBI-GeneID: 100668387
NCBI-ProteinID: XP_003419664
LinkDB
Position
Unknown
AA seq 167 aa
MFQIPEFEQSDREDSTPADRGLGPSPEGYWPSGPSDRHRVAPGFLRDSSHQQGQPTSSGH
HGGAAAVETRSRHSSYPAGSDEAEGLEEDPSPFRGRSLSAPPNLWAAQRYGRELRRMSDE
FQGYFKGLPRPKSAGTATQMRQSPSWTRIIQAWWDRNLGRGSSAPSQ
NT seq 504 nt   +upstreamnt  +downstreamnt
atgttccagatcccagagtttgagcagagtgaccgggaagactccacccctgcagacagg
ggcctgggccccagccccgaagggtactggccttcaggccccagcgaccgccaccgtgtg
gccccaggcttcctgcgggactccagtcaccagcaggggcagccgaccagcagcggccac
catggaggtgctgcggctgtggagacccggagtcgccacagctcataccccgcagggtct
gatgaggctgaagggctggaggaggatcccagcccctttcggggtcgctcgctttcagcg
ccccccaacctctgggctgcacagagatatggccgtgagctccgcaggatgagtgatgag
ttccagggctatttcaagggacttcctcgcccgaagagcgcgggcacagcaacgcagatg
cggcaaagccccagctggacacgcatcatccaggcctggtgggatcggaatttggggaga
ggcagctccgccccgtctcagtga

DBGET integrated database retrieval system