KEGG   Loxodonta africana (African savanna elephant): 100668424
Entry
100668424         CDS       T04351                                 

Gene name
STAT1
Definition
(RefSeq) signal transducer and activator of transcription 1-alpha/beta
  KO
K11220  signal transducer and activator of transcription 1
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04062  Chemokine signaling pathway
lav04217  Necroptosis
lav04380  Osteoclast differentiation
lav04620  Toll-like receptor signaling pathway
lav04621  NOD-like receptor signaling pathway
lav04625  C-type lectin receptor signaling pathway
lav04630  JAK-STAT signaling pathway
lav04658  Th1 and Th2 cell differentiation
lav04659  Th17 cell differentiation
lav04917  Prolactin signaling pathway
lav04919  Thyroid hormone signaling pathway
lav04933  AGE-RAGE signaling pathway in diabetic complications
lav04935  Growth hormone synthesis, secretion and action
lav05140  Leishmaniasis
lav05145  Toxoplasmosis
lav05152  Tuberculosis
lav05160  Hepatitis C
lav05161  Hepatitis B
lav05162  Measles
lav05164  Influenza A
lav05165  Human papillomavirus infection
lav05167  Kaposi sarcoma-associated herpesvirus infection
lav05168  Herpes simplex virus 1 infection
lav05169  Epstein-Barr virus infection
lav05171  Coronavirus disease - COVID-19
lav05200  Pathways in cancer
lav05212  Pancreatic cancer
lav05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
lav05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100668424 (STAT1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100668424 (STAT1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100668424 (STAT1)
   04621 NOD-like receptor signaling pathway
    100668424 (STAT1)
   04625 C-type lectin receptor signaling pathway
    100668424 (STAT1)
   04658 Th1 and Th2 cell differentiation
    100668424 (STAT1)
   04659 Th17 cell differentiation
    100668424 (STAT1)
   04062 Chemokine signaling pathway
    100668424 (STAT1)
  09152 Endocrine system
   04917 Prolactin signaling pathway
    100668424 (STAT1)
   04935 Growth hormone synthesis, secretion and action
    100668424 (STAT1)
   04919 Thyroid hormone signaling pathway
    100668424 (STAT1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100668424 (STAT1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100668424 (STAT1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100668424 (STAT1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    100668424 (STAT1)
  09163 Immune disease
   05321 Inflammatory bowel disease
    100668424 (STAT1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100668424 (STAT1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100668424 (STAT1)
  09172 Infectious disease: viral
   05161 Hepatitis B
    100668424 (STAT1)
   05160 Hepatitis C
    100668424 (STAT1)
   05171 Coronavirus disease - COVID-19
    100668424 (STAT1)
   05164 Influenza A
    100668424 (STAT1)
   05162 Measles
    100668424 (STAT1)
   05168 Herpes simplex virus 1 infection
    100668424 (STAT1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100668424 (STAT1)
   05169 Epstein-Barr virus infection
    100668424 (STAT1)
   05165 Human papillomavirus infection
    100668424 (STAT1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100668424 (STAT1)
   05140 Leishmaniasis
    100668424 (STAT1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:lav03000]
    100668424 (STAT1)
Transcription factors [BR:lav03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    100668424 (STAT1)
SSDB
Motif
Pfam: STAT_alpha STAT_int STAT_bind STAT1_TAZ2bind SH2 BLI1
Other DBs
NCBI-GeneID: 100668424
NCBI-ProteinID: XP_010600974
LinkDB
Position
Unknown
AA seq 750 aa
MSQWYELQQLDSKFLEQVHQLYDDSFPMEVRQYLAQWLEKQDWEHAANDVSFATIRFHDL
LSQLDDQYSRFSLENNFLLQHNIRKSKRNLQDNFQEDPILMSMIICNCLKEERKILENAQ
RFNQAQSGNIQSTVMLDKQKELDSKVRNVKDKVMCIEHEIKTLEDLQDEYDFKCKTLQNR
EHETSGAAKNEQKEEQMLLQKMYLMLDNKRKEVVHKIIELLNVTELTQNALINDELVEWK
RRQQSACIGGPPNACLDQLQNWFTIVAESLQQARQQLKKLEELEQKYTYEHDPITKNKQV
LWDRTFTLFQQLIQSSFVVERQPCMPTHPQRPLVLKTGVQFTVKLRLLVKLQELNYNLTV
KVLFDKDVNERNTVKGFRKFNILGTHKKVMNMEESTNGSLAAEFRHLQLKEQKNAGTRTN
EGPLIVTEELHSFSFETQLCQPGLVIDLETTSLPVVVISNVSQLPSGWASILWYNMLVAE
PRNLSFFLNPPCAQWAQLSEVLSWQFSSVTKRGLSVDQLNMLGEKLLGPNAGPDGLIPWT
RFCKENINDKNFPFWLWIESILELIKKHLLSLWNDGCIVGFISKERERALLKDQQPGTFL
LRFSESCREGAITFTWVERSQNGGEPCFHAVEPYTKKELSAVTFPDIIRNYKVMAAENIP
ENPLKYLYPNIDKDHALGKYYSRPKEAPEPMELDGPRGTGYIKTELISVSEVHPSRLQTT
ENLLPMSPEEFDEVSRIVGSVEFDTMMNAV
NT seq 2253 nt   +upstreamnt  +downstreamnt
atgtctcagtggtacgagcttcagcagcttgactccaaattcctagagcaggttcaccag
ctttatgatgacagttttcccatggaagtcagacagtacctggcccagtggctagaaaag
caagactgggagcatgctgccaacgatgtttcatttgctaccattcgttttcacgacctg
ttatcacagctggatgatcagtatagccgcttttcgttggagaacaattttttgttgcag
cataacatacggaaaagcaagcgcaatcttcaggataattttcaggaagacccaatactg
atgtctatgatcatctgtaactgtctgaaggaggaaaggaagatcctggaaaatgctcag
agatttaatcaggctcagtcagggaatattcagagcactgtgatgttagacaaacagaag
gagcttgacagcaaagtcagaaatgtgaaagacaaagttatgtgtatagagcatgaaatc
aagaccctagaagatttacaagatgaatatgactttaaatgcaaaaccttgcagaacaga
gaacatgaaaccagcggtgcggccaagaatgaacagaaagaagaacagatgttactccag
aagatgtatttaatgcttgacaataagagaaaggaagtggttcataaaataatagaattg
ttaaatgtcactgaacttacccagaatgccctcattaatgatgagcttgtggaatggaag
cggagacagcagagtgcctgtattgggggaccgcccaacgcctgccttgatcagctgcag
aactggtttaccatagttgcagagagtctacagcaggctcgtcagcagctcaaaaagctt
gaggagctggaacagaagtacacctacgagcatgaccccatcacaaaaaacaaacaagtg
ttatgggaccgcaccttcactctgttccagcagctcattcagagctcgtttgtggtggag
agacaaccttgcatgccaactcacccacagaggccactggtcctgaagactggggtccag
ttcactgtgaagttgagactgctggtgaaattacaggagctgaattataatttaacagtc
aaagtcttgtttgacaaagatgtgaatgagagaaacacagtaaagggatttagaaaattc
aacatcttgggcacacataagaaagtgatgaacatggaggaatccaccaatggaagtctg
gcagcagaatttcgacacctgcaactgaaagaacagaaaaacgctggcaccagaactaat
gagggccctctcatcgttactgaagagcttcattcctttagctttgaaacccagttgtgc
cagccgggcttggtaattgaccttgagacgacctctctgcctgttgtggtgatctccaac
gtcagccagctcccaagtggttgggcctccatcctgtggtacaacatgctggtggcagaa
cccaggaatctgtccttcttcctgaacccaccatgtgcccaatgggcgcagctttcagag
gtgctgagttggcagttttcttctgtcaccaaaagaggtctcagtgtggaccagctgaac
atgttgggagagaagcttcttggtcctaatgctggtcccgatggtcttattccgtggacg
aggttttgtaaggaaaatatcaatgataaaaatttcccgttctggctttggattgaaagc
atccttgaactcattaaaaaacacctgctttctctctggaatgatgggtgtatcgtgggc
ttcatcagcaaggaacgagaacgcgccctgctgaaggaccagcagcctgggacgttcctg
ctgcggtttagcgagagctgccgggaaggggccatcacgttcacatgggtggagcggtcc
cagaacggaggcgaaccctgtttccatgcagttgaaccctacacaaagaaagaactttct
gccgttactttccctgatatcattcgcaattacaaagtcatggctgccgagaatattcca
gagaatcccctgaagtatttgtatccaaatattgataaagaccatgcgcttggaaagtat
tactccaggccaaaggaagcaccagaaccgatggaactcgatggtcctagaggaactgga
tacatcaagaccgagttgatttctgtgtctgaagttcacccttctagacttcagactacg
gaaaaccttctccccatgtctcctgaggagtttgatgaggtgtcgcggatagtggggtct
gtagaattcgacactatgatgaacgcagtatag

KEGG   Loxodonta africana (African savanna elephant): 100669299
Entry
100669299         CDS       T04351                                 

Gene name
STAT5B
Definition
(RefSeq) signal transducer and activator of transcription 5B isoform X1
  KO
K11224  signal transducer and activator of transcription 5B
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04012  ErbB signaling pathway
lav04062  Chemokine signaling pathway
lav04217  Necroptosis
lav04630  JAK-STAT signaling pathway
lav04658  Th1 and Th2 cell differentiation
lav04659  Th17 cell differentiation
lav04917  Prolactin signaling pathway
lav04933  AGE-RAGE signaling pathway in diabetic complications
lav04935  Growth hormone synthesis, secretion and action
lav05161  Hepatitis B
lav05162  Measles
lav05166  Human T-cell leukemia virus 1 infection
lav05200  Pathways in cancer
lav05203  Viral carcinogenesis
lav05220  Chronic myeloid leukemia
lav05221  Acute myeloid leukemia
lav05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100669299 (STAT5B)
   04630 JAK-STAT signaling pathway
    100669299 (STAT5B)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100669299 (STAT5B)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    100669299 (STAT5B)
   04659 Th17 cell differentiation
    100669299 (STAT5B)
   04062 Chemokine signaling pathway
    100669299 (STAT5B)
  09152 Endocrine system
   04917 Prolactin signaling pathway
    100669299 (STAT5B)
   04935 Growth hormone synthesis, secretion and action
    100669299 (STAT5B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100669299 (STAT5B)
   05203 Viral carcinogenesis
    100669299 (STAT5B)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    100669299 (STAT5B)
   05220 Chronic myeloid leukemia
    100669299 (STAT5B)
   05223 Non-small cell lung cancer
    100669299 (STAT5B)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100669299 (STAT5B)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100669299 (STAT5B)
   05161 Hepatitis B
    100669299 (STAT5B)
   05162 Measles
    100669299 (STAT5B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:lav03000]
    100669299 (STAT5B)
Transcription factors [BR:lav03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    100669299 (STAT5B)
SSDB
Motif
Pfam: STAT_bind STAT_alpha STAT_int SH2
Other DBs
NCBI-GeneID: 100669299
NCBI-ProteinID: XP_003414285
UniProt: G3TCH4
LinkDB
Position
Unknown
AA seq 787 aa
MAVWIQAQQLQGDALHQMQALYGQHFPIEVRHYLSQWIESQAWDSIDLDNPQENIKATQL
LEGLVQELQKKAEHQVGEDGFLLKIKLGHYATQLQNTYDRCPMELVRCIRHILYNEQRLV
REANNGSSPAGSLADAMSQKHLQINQTFEELRLVTQDTENELKKLQQTQEYFIIQYQESL
RIQAQFAQLAQLNPQERLSRETALQQKQVSLEAWLQREAQTLQQYRVELAEKHQKTLQLL
RKQQTIILDDELIQWKRRQQLAGNGGPPEGSLDVLQSWCEKLAEIIWQNRQQIRRAEHLC
QQLPIPGPVEEMLADVNATITDIISALVTSTFIIEKQPPQVLKTQTKFAATVRLLVGGKL
NVHMNPPQVKATIISEQQAKSLLKNENTRNDYSGEILNNCCVMEYHQATGTLSAHFRNMS
LKRIKRSDRRGAESVTEEKFTILFESQFSVGGNELVFQVKTLSLPVVVIVHGSQDNNATA
TVLWDNAFAEPGRVPFAVPDKVLWPQLCEALNMKFKAEVQSNRGLTKENLVFLAQKLFNS
GNSHLEDYSSMSVSWSQFNRENLPGRNYTFWQWFDGVMEVLKKHLKPHWNDGAILGFVNK
QQAHDLLINKPDGTFLLRFSDSEIGGITIAWKFDSQERMFWNLMPFTTRDFSIRSLADRL
GDLNYLIYVFPDRPKDEVYSKYYTPVPCEPATAKAADGYVKPQIKQVVPEFVNASADSAG
GGATYMDQAPSPAVCAQAHYNMYPQNPDSVLDTDGDFDLDDTMDVARRVEELLGRPMDSQ
WIPHAQS
NT seq 2364 nt   +upstreamnt  +downstreamnt
atggctgtgtggatacaagcccagcagctccagggagatgcccttcatcaaatgcaagca
ttatatggccagcattttcccatcgaggtgcggcattacttatcccagtggattgaaagc
caagcttgggactcaatagatcttgataatccacaggagaacattaaggccacccagctc
ctggagggcctggtgcaggagctgcagaagaaggctgagcaccaagtgggggaagatggg
tttttactgaagatcaagctggggcactatgccacacagctccagaacacgtatgaccgc
tgccccatggagctggttcgatgcatccgccacatcttatacaatgaacagaggctggtc
cgagaagccaacaatggtagttctccagctgggagccttgccgatgccatgtcccagaaa
caccttcagatcaaccagacgtttgaggagctgcgactggtcacacaggatacagagaat
gagctgaagaagctgcagcagactcaagagtatttcatcatccaatatcaagagagcctg
aggatccaagctcagtttgcccagctggcccagctgaacccccaggagcggctgagccgg
gagacagccctccagcagaaacaggtgtcactggaagcctggctgcagcgtgaggcccag
acactacagcagtaccgtgtggagctggccgagaagcaccagaagaccctgcagctgctg
cggaagcagcagaccatcatcctggacgacgagctgatccaatggaagcggaggcagcag
ctggccgggaatggagggccccccgagggcagcctggacgtgctgcagtcctggtgtgag
aagctggccgagatcatctggcagaaccggcagcagatccgcagagctgagcacctgtgc
cagcagcttcccatcccaggccccgtggaggagatgctggctgacgtcaacgccaccatc
acagacatcatctcagccctggtgaccagtacattcatcatcgagaagcagccccctcag
gtcctgaagacgcagaccaagtttgcagccacagtgcgcctgctggtaggcgggaagctg
aacgtgcacatgaaccctccccaggtgaaggcgaccatcatcagcgagcagcaggccaag
tctctgctcaaaaacgagaacacccgcaatgactacagtggggagatcttgaacaactgc
tgtgtgatggaataccaccaagccacaggcaccctcagcgcccacttcagaaacatgtcc
ctgaaacgaattaagagatctgaccgtcgaggagcagagtcagtgacagaagaaaaattt
acaatcctatttgaatcacagttcagtgttggtggaaatgagctggtttttcaggtcaag
accctgtccctcccggtggtggtgattgttcatggcagccaggacaacaatgcaacggcc
accgttctctgggacaacgcttttgcagagcctggcagggtgccatttgccgtgccggac
aaagtgctctggccgcagctgtgtgaagcactcaacatgaagttcaaggcagaagtgcag
agcaaccggggcctgaccaaggagaacctcgtgttcctggcgcagaagctgttcaacagc
ggcaacagccacctggaggactacagcagcatgtctgtgtcttggtcccagttcaacagg
gagaatttaccaggacggaattacactttctggcagtggtttgacggtgtgatggaagtg
ttaaaaaaacatctcaagcctcactggaatgatggggccattttaggttttgtgaacaag
caacaggcccacgacctactcattaacaagccagatgggaccttcctgctgagattcagc
gactctgaaatcggcggcatcaccatcgcttggaagtttgactctcaggaaagaatgttt
tggaacctgatgccttttactaccagagacttctctatccggtccctggccgaccgcttg
ggggacctgaattaccttatctacgtgtttcctgaccggcccaaagatgaagtgtactcc
aaatattacacaccagttccgtgcgagcctgccactgctaaagccgccgatggatacgtg
aagccacagatcaagcaggtggtccctgagtttgtgaatgcttctgcagactctgctggg
ggcggcgccacgtacatggaccaggccccatccccagctgtgtgcgcccaggctcactat
aacatgtatccacagaaccctgactccgtccttgacacagatggggatttcgacctggat
gacaccatggacgttgcgcggcgtgtggaggagctcttgggccgaccaatggacagtcag
tggatcccccatgcgcagtcatga

KEGG   Loxodonta africana (African savanna elephant): 100669583
Entry
100669583         CDS       T04351                                 

Gene name
STAT3
Definition
(RefSeq) signal transducer and activator of transcription 3 isoform X2
  KO
K04692  signal transducer and activator of transcription 3
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav01521  EGFR tyrosine kinase inhibitor resistance
lav04062  Chemokine signaling pathway
lav04066  HIF-1 signaling pathway
lav04068  FoxO signaling pathway
lav04217  Necroptosis
lav04550  Signaling pathways regulating pluripotency of stem cells
lav04630  JAK-STAT signaling pathway
lav04659  Th17 cell differentiation
lav04917  Prolactin signaling pathway
lav04920  Adipocytokine signaling pathway
lav04931  Insulin resistance
lav04933  AGE-RAGE signaling pathway in diabetic complications
lav04935  Growth hormone synthesis, secretion and action
lav05145  Toxoplasmosis
lav05160  Hepatitis C
lav05161  Hepatitis B
lav05162  Measles
lav05163  Human cytomegalovirus infection
lav05167  Kaposi sarcoma-associated herpesvirus infection
lav05169  Epstein-Barr virus infection
lav05171  Coronavirus disease - COVID-19
lav05200  Pathways in cancer
lav05203  Viral carcinogenesis
lav05205  Proteoglycans in cancer
lav05206  MicroRNAs in cancer
lav05212  Pancreatic cancer
lav05221  Acute myeloid leukemia
lav05223  Non-small cell lung cancer
lav05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
lav05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100669583 (STAT3)
   04066 HIF-1 signaling pathway
    100669583 (STAT3)
   04068 FoxO signaling pathway
    100669583 (STAT3)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100669583 (STAT3)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100669583 (STAT3)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    100669583 (STAT3)
   04062 Chemokine signaling pathway
    100669583 (STAT3)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    100669583 (STAT3)
   04917 Prolactin signaling pathway
    100669583 (STAT3)
   04935 Growth hormone synthesis, secretion and action
    100669583 (STAT3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100669583 (STAT3)
   05206 MicroRNAs in cancer
    100669583 (STAT3)
   05205 Proteoglycans in cancer
    100669583 (STAT3)
   05203 Viral carcinogenesis
    100669583 (STAT3)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100669583 (STAT3)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    100669583 (STAT3)
   05221 Acute myeloid leukemia
    100669583 (STAT3)
   05223 Non-small cell lung cancer
    100669583 (STAT3)
  09163 Immune disease
   05321 Inflammatory bowel disease
    100669583 (STAT3)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    100669583 (STAT3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100669583 (STAT3)
  09172 Infectious disease: viral
   05161 Hepatitis B
    100669583 (STAT3)
   05160 Hepatitis C
    100669583 (STAT3)
   05171 Coronavirus disease - COVID-19
    100669583 (STAT3)
   05162 Measles
    100669583 (STAT3)
   05163 Human cytomegalovirus infection
    100669583 (STAT3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100669583 (STAT3)
   05169 Epstein-Barr virus infection
    100669583 (STAT3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100669583 (STAT3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100669583 (STAT3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:lav03000]
    100669583 (STAT3)
Transcription factors [BR:lav03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    100669583 (STAT3)
SSDB
Motif
Pfam: STAT_alpha STAT_bind STAT_int SH2 E2R135 DUF4795 Syntaxin-6_N AP1AR Fib_alpha
Other DBs
NCBI-GeneID: 100669583
NCBI-ProteinID: XP_003414286
LinkDB
Position
Unknown
AA seq 769 aa
MAQWNQLQQLDTRYLEQLHQLYSDSFPMELRQFLAPWIESQDWAYAASKESHATLVFHNL
LGEIDQQYSRFLQESNVLYQHNLRRIKQFLQSRYLEKPMEIARIVARCLWEESRLLQTAA
TAAQQGGQANHPTAAVVTEKQQMLEQHLQDVRKRVQDLEQKMKVVENLQDDFDFNYKTLK
SQGDMQDLNGNNQSVTRQKMQQLEQMLTALDQMRRSIVSELAGLLSAMEYVQKTLTDEEL
ADWKRRQQIACIGGPPNICLDRLENWITSLAESQLQTRQQIKKLEELQQKVSYKGDPIVQ
HRPMLEERIVELFRNLMKSAFVVERQPCMPMHPDRPLVIKTGVQFTTKVRLLVKFPELNY
QLKIKVCIDKDSGDVAALRGSRKFNILGTNTKVMNMEESNNGSLSAEFKHLTLREQRCGN
GGRANCDASLIVTEELHLITFETEVYHQGLKIDLETHSLPVVVISNICQMPNAWASILWY
NMLTNNPKNVNFFTKPPIGTWDQVAEVLSWQFSSTTKRGLSIEQLTTLAEKLLGPGVNYS
GCQITWAKFCKENMAGKGFSFWVWLDNIIDLVKKYILALWNEGYIMGFISKERERAILST
KPPGTFLLRFSESSKEGGITFTWVEKDISGKTQIQSVEPYTKQQLNNMSFAEIIMGYKIM
DATNILVSPLVYLYPDIPKEEAFGKYCRPESQEHPEADPGAAPYLKTKFICVTPTTCSNT
IDLPMSPRTLDSLMQFGNNGEGAEPSAGGQFESLTFDMDLTSECATSPM
NT seq 2310 nt   +upstreamnt  +downstreamnt
atggcccaatggaatcagctacagcagctcgacacgcggtacctggagcagttgcatcag
ctgtacagtgacagcttcccgatggagctaaggcagtttctggccccttggattgagagt
caagattgggcatatgctgccagcaaagaatcacatgccactttggtatttcataatctc
ttgggtgagattgaccagcagtatagccgctttctacaagagtcaaatgttctctatcag
cacaaccttcgaagaatcaagcagttccttcagagcagatatcttgagaagccaatggag
attgctcgaattgtggcccggtgcctgtgggaagagtcccgcctcctccaaactgcagcc
actgcagcccagcaagggggccaggccaaccaccctacagctgctgtggtgacagagaag
cagcagatgctggagcagcacctacaggatgttcggaagagggttcaggatctagaacag
aaaatgaaagtggtagagaacctccaggatgactttgatttcaactataaaaccctcaag
agtcaaggagacatgcaagatctgaatggaaacaaccagtcagtgaccaggcagaagatg
cagcagcttgaacagatgcttacagcgctggaccagatgcgaagaagcattgtgagtgag
ttggctgggcttttgtcagcaatggagtacgtgcagaaaactctcacggatgaagagctg
gctgactggaagaggaggcaacagattgcttgcattggaggccctcccaacatctgccta
gatcgcctagaaaactggataacctcattagcagaatctcaacttcagacccgccagcaa
attaagaaactggaggagttacagcaaaaagtttcctataaaggggaccccattgtacag
caccggccaatgctggaggagagaattgtagagctgtttagaaacttaatgaaaagtgcc
ttcgtggttgagcggcagccctgcatgcccatgcaccctgaccggcccttggtcatcaag
actggtgtccagtttactactaaagtcaggttgttggtcaagttccctgagttaaattat
cagcttaaaattaaagtgtgcattgacaaagactctggggatgttgcagctctcagagga
tcccggaaatttaacattctgggcacaaacacaaaagtgatgaacatggaagagtccaac
aatggcagcctgtctgcagaattcaagcacttgaccctgagggagcaaagatgtggtaat
gggggccgagcaaattgtgatgcctccctaattgtgaccgaggagctgcacctgatcact
tttgagactgaggtatatcaccaaggcctcaagattgacctggagacccactctttgcct
gttgtggtgatctccaatatttgtcagatgccaaatgcctgggcttccatcctgtggtat
aacatgctgaccaacaaccccaagaacgtgaacttttttaccaagcccccaatcggaacc
tgggatcaagtggccgaggtgctgagctggcagttctcctccaccacaaagcgagggttg
agcattgaacaattgactacgctggcagagaagctcttgggacctggtgtgaactactca
gggtgtcagatcacttgggctaaattttgcaaagaaaacatggctggcaaaggcttctct
ttctgggtctggctggacaatatcattgaccttgtgaaaaaatacatcctggccctttgg
aatgaagggtacataatgggcttcatcagtaaggagcgggagcgggccatcctgagcacc
aagcccccaggcaccttcctgctaagattcagtgaaagcagcaaagaaggaggaatcacc
ttcacttgggtggagaaggacatcagcggtaagacccagatccagtctgtggaaccatat
accaaacagcagctgaacaacatgtcatttgctgaaatcatcatgggctataagatcatg
gatgccaccaacatcctggtgtctccgctggtctatctctaccctgacattcctaaggag
gaggcgtttggaaagtattgtcggccagagagccaggagcatcctgaagctgacccaggt
gctgccccatacctgaagaccaagtttatctgtgtgacaccaacgacctgcagcaatacc
attgacctgccgatgtccccccgcactttagattcattgatgcagtttggaaataatggt
gaaggtgctgaaccctcagcaggagggcagtttgagtccctgacctttgacatggacttg
acctcggagtgcgctacctcgcccatgtga

KEGG   Loxodonta africana (African savanna elephant): 100672448
Entry
100672448         CDS       T04351                                 

Definition
(RefSeq) signal transducer and activator of transcription 5A
  KO
K11223  signal transducer and activator of transcription 5A
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04012  ErbB signaling pathway
lav04217  Necroptosis
lav04630  JAK-STAT signaling pathway
lav04658  Th1 and Th2 cell differentiation
lav04659  Th17 cell differentiation
lav04917  Prolactin signaling pathway
lav04933  AGE-RAGE signaling pathway in diabetic complications
lav04935  Growth hormone synthesis, secretion and action
lav05161  Hepatitis B
lav05162  Measles
lav05166  Human T-cell leukemia virus 1 infection
lav05200  Pathways in cancer
lav05203  Viral carcinogenesis
lav05220  Chronic myeloid leukemia
lav05221  Acute myeloid leukemia
lav05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100672448
   04630 JAK-STAT signaling pathway
    100672448
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100672448
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    100672448
   04659 Th17 cell differentiation
    100672448
  09152 Endocrine system
   04917 Prolactin signaling pathway
    100672448
   04935 Growth hormone synthesis, secretion and action
    100672448
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100672448
   05203 Viral carcinogenesis
    100672448
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    100672448
   05220 Chronic myeloid leukemia
    100672448
   05223 Non-small cell lung cancer
    100672448
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100672448
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100672448
   05161 Hepatitis B
    100672448
   05162 Measles
    100672448
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:lav03000]
    100672448
Transcription factors [BR:lav03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    100672448
SSDB
Motif
Pfam: STAT_bind STAT_alpha STAT_int SH2
Other DBs
NCBI-GeneID: 100672448
NCBI-ProteinID: XP_010592767
LinkDB
Position
Unknown
AA seq 763 aa
MAGWIQAQQLQGDALRQMQVLYGQHFPIEVRHYLAQWIESQPWDAIDLDNPQDRAQATQL
LEGLVQELQKKAEHQVGEDGFLLKIKLGHYATQLQCSSPAGNLVDAMSQKHLQINQTFEE
LRLVTQDTENELKKLQQTQEYFIIQYQESLRIQAQFAQLAQLNPQERLSRETALQQKQVS
LEAWLQREAQTLQQYRVVSGKHQKTLQLLRTQQTIILDDELIQWKRRQQLAGNGGPPEGS
LDVLQSWCEKLAEIIWQNRQQIRRAEHLCQQLPIPGPVEEMLADVNATITDIISALVTST
FIIEKQPPQVLKTQTKFAATVRLLVGGKLNVHMNPPQVKATIISEQQAKSLLKNENTRNE
CSGEILNNCCVMEYHQATGTLSAHFRNMSLKRIKRADRRGAESVTEEKFTVLFESQFSVG
SNELVFQVKTLSLPVVVIVHGSQDHNATATVLWDNAFAEPGRVPFAVPDKVLWPQLCEAL
NMKFKAEVQSNRGLTKENLVFLAQKLFNSGNSHLEDYSSMSVSWSQFNRENLPGWNYTFW
QWFDGVMEVLKKHHKPHWNDGAILGFVNKQQAHDLLINKPDGTFLLRFSDSEIGGITIAW
KFDSPDRNLWNLKPFTTRDFSIRSLADRLGDLNYLIYVFPDRPKDEVFSKYYTPVLAKAI
DGYVKPQIKQVVPEFVNASADSAGGSATYVDQAPSPAVCAQAHYNMYPQNPDPVLDQDGE
IDLDETMDVARHVEELLRRPMDNLGPPLAPPDGFFTAARGSLS
NT seq 2292 nt   +upstreamnt  +downstreamnt
atggcgggctggatccaggcccagcagctgcagggagatgcgctgcgccagatgcaggtg
ctctatgggcagcacttccccatcgaggtccgccactacttggcgcagtggattgagagc
cagccatgggatgccatcgacctagacaatccccaggaccgagcccaggccacccagctc
ctagagggcctggtgcaggagctgcagaagaaggccgagcaccaagtgggggaagatggg
tttttactgaagatcaagctggggcactatgccacacagctccagtgcagctctcctgct
gggaacctggttgatgccatgtcccagaaacaccttcagatcaaccagacatttgaggag
ctgcgactggtcacacaggatacagaaaatgagctgaagaagctgcagcagactcaagag
tatttcatcatccaatatcaagagagcctgaggatccaagctcagtttgcccagctggcc
cagctgaacccccaggagcggctgagccgggagacagccctccagcagaaacaggtgtca
ctggaagcctggctgcagcgtgaggcccagacactacagcagtaccgtgtggtgagtggg
aagcaccagaagaccctgcagctgctgcggacgcagcagaccatcatcctggacgacgag
ctgatccaatggaagcggaggcagcagctggccgggaatggagggccccccgagggcagc
ctggacgtgctgcagtcctggtgtgagaagctggccgagatcatctggcagaaccggcag
cagatccgcagagctgagcacctgtgccagcagcttcccatcccaggccccgtggaggag
atgctggctgacgtcaacgccaccatcacagacatcatctcagccctggtgaccagtaca
ttcatcatcgagaagcagccccctcaggtcctgaagacgcagaccaagtttgcagccaca
gtgcgcctgctggtaggcgggaagctgaacgtgcacatgaaccctccccaggtgaaggcg
accatcatcagcgagcagcaggccaagtctctgctcaaaaacgagaacacccgcaacgag
tgcagtggggagatcttgaacaactgctgtgtgatggaataccaccaagccacaggcacc
ctcagcgcccacttcagaaacatgtcactaaagaggatcaagcgtgctgaccggcggggc
gcagagtccgtgacggaggagaaattcacggtgctgtttgagtctcagtttagcgttggc
agcaatgagcttgtgttccaggtgaagaccctgtcccttcccgtggttgtcattgttcat
ggaagtcaggatcacaatgccactgccactgtgttgtgggacaatgcctttgctgagccg
ggcagggtgccatttgctgtgccggacaaagtgctctggccgcagctgtgtgaagcactc
aacatgaagttcaaggcagaagtgcagagcaaccggggcctgaccaaggagaacctcgtg
ttcctggcgcagaagctgttcaacagcggcaacagccacctggaggactacagcagcatg
tctgtgtcttggtcccagttcaacagggagaacttgccgggctggaactacaccttctgg
cagtggttcgacggggtgatggaggtgctaaagaagcatcacaagccccattggaatgac
ggggctatcctagggtttgtgaataagcaacaggcccatgacctgctcatcaacaagccc
gatgggaccttcttgttgcgctttagcgactcggaaatcgggggcatcaccattgcctgg
aagtttgactctcctgaccgcaacttgtggaacctgaagccgtttaccacgagggatttc
tccatccgctccctggctgaccgcctgggggacctgaactatctcatctacgtgttccct
gaccgccccaaggatgaggtcttctccaaatactacacccctgtgctagctaaagccatt
gacggatacgtgaagccacagatcaagcaagtggtccctgagtttgtgaacgcctctgca
gactctgctgggggcagcgccacgtacgtggaccaggccccgtccccagctgtgtgcgcc
caggctcactataacatgtatccacagaaccctgaccctgtcctcgaccaggatggagag
atcgatctggacgagaccatggatgttgcgaggcatgtggaggaactcctacgccgcccg
atggacaatctgggcccccctcttgctcccccagatggcttcttcaccgcagccaggggc
tcgctttcatga

DBGET integrated database retrieval system