KEGG   Loxodonta africana (African savanna elephant): 100668436
Entry
100668436         CDS       T04351                                 

Gene name
PTK2
Definition
(RefSeq) LOW QUALITY PROTEIN: focal adhesion kinase 1
  KO
K05725  focal adhesion kinase 1 [EC:2.7.10.2]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav01522  Endocrine resistance
lav04012  ErbB signaling pathway
lav04062  Chemokine signaling pathway
lav04151  PI3K-Akt signaling pathway
lav04360  Axon guidance
lav04370  VEGF signaling pathway
lav04510  Focal adhesion
lav04670  Leukocyte transendothelial migration
lav04810  Regulation of actin cytoskeleton
lav04935  Growth hormone synthesis, secretion and action
lav05100  Bacterial invasion of epithelial cells
lav05135  Yersinia infection
lav05146  Amoebiasis
lav05163  Human cytomegalovirus infection
lav05165  Human papillomavirus infection
lav05170  Human immunodeficiency virus 1 infection
lav05200  Pathways in cancer
lav05202  Transcriptional misregulation in cancer
lav05205  Proteoglycans in cancer
lav05222  Small cell lung cancer
lav05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100668436 (PTK2)
   04370 VEGF signaling pathway
    100668436 (PTK2)
   04151 PI3K-Akt signaling pathway
    100668436 (PTK2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100668436 (PTK2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100668436 (PTK2)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    100668436 (PTK2)
   04062 Chemokine signaling pathway
    100668436 (PTK2)
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    100668436 (PTK2)
  09158 Development and regeneration
   04360 Axon guidance
    100668436 (PTK2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100668436 (PTK2)
   05202 Transcriptional misregulation in cancer
    100668436 (PTK2)
   05205 Proteoglycans in cancer
    100668436 (PTK2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    100668436 (PTK2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100668436 (PTK2)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100668436 (PTK2)
   05100 Bacterial invasion of epithelial cells
    100668436 (PTK2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100668436 (PTK2)
   05163 Human cytomegalovirus infection
    100668436 (PTK2)
   05165 Human papillomavirus infection
    100668436 (PTK2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100668436 (PTK2)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100668436 (PTK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lav01001]
    100668436 (PTK2)
   01009 Protein phosphatases and associated proteins [BR:lav01009]
    100668436 (PTK2)
Enzymes [BR:lav01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     100668436 (PTK2)
Protein kinases [BR:lav01001]
 Non-receptor tyrosine kinases
  FAK family
   100668436 (PTK2)
Protein phosphatases and associated proteins [BR:lav01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100668436 (PTK2)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Focal_AT Pkinase FERM_N_2 FERM_M FERM_F2 Kinase-like NeA_P2
Other DBs
NCBI-GeneID: 100668436
NCBI-ProteinID: XP_023401805
LinkDB
Position
Unknown
AA seq 1096 aa
MLLEVAGPEALDPAGAVCMARSGCSPFPMCWAEEYDRYLASSKIMAAAYLDPNLNHTPNS
STKTHLGTGMERSPGTMERVLKVFHYFESNSEPTTWASIIRHGDATDVRGIIQKIVDSHK
VKHVACYGFRLSHLLSEEVHWLHLDMGVSNVREKYELAHPPEEWKYELRIRYLPKGFLNQ
FTEDKPTLNFFYQQVKSDYMLEIADQVDQEIALKLGCLEIRRSYWEMRGNALEKKSNYEV
LEKDVGLKRFFPKSLLDSVKAKTLRKLIQQTFRQFANLNREESILKFFEILSPVYRFDKE
CFKCALGSSWIISVELAIGPEEGISYLTDKGCNPTHLADFNQVQTIQYSNSEDKDRKGML
QLKIAGAPEPLTVTAPSLTIAENMADLIDGYCRLVNGATQSFIIRPQKEGERALPSIPKL
ANSEKQGVRTHAVSVSETDDYAEIIDEEDTYTMPSTRDYEIQRERIELGRCIGEGQFGDV
HQGVYMSPENPALAVAIKTCKNCTSDSVREKFLQEALTMRQFDHPHIVKLIGVITENPVW
IIMELCTLGELRSFLQMRKYSLDLASLILYAYQLSTALAYLESKRFVHRDIAARNVLVSS
PDCVKLGDFGLSRCMEDSTYYKASKGKLPIKWMAPESINFRRFTSASDVWMFGVCMWEIL
MHGVKPFQGVKNNDVIGRIENGERLPMPPNCPPTLYSLMTKCWAYDPSRRPRFTELKAQL
STILEEEKVQQEERMRMESRRQVTVSWDSGGSDEAPPKPSRPGYPSPRSSEGFYPSPQHV
VQTNHYQVSGYPGSHGITAMAGSIYPGQASLLDQTDSWNHRPQEVSMWQPNVEDSAALDM
RGIGQVLPAHLMEERLIRQQQEMEEDQRWLEKEERFLKPDVRLSRGSIDREDGGLQGPTG
NQHIYQPVGKPDPAAPPKKPPRPGAPSHLGSLASLSSPGDSYNEGVKLQPQEISPPPTAN
LDRSNDKVYENVTGLVKAVIEMSSKIQPAPPEEYVPMVKEVGLALRTLLATVDETIPVLP
ASTHREIEMAQKLLNSDLGGLINKMKLAQQYVMTSLQQEYKKQMLTAAHALAVDAKNLLD
VIDQARLKMLAQTRPH
NT seq 3291 nt   +upstreamnt  +downstreamnt
atgttgttggaagtggcgggccccgaggccctggatccagcaggtgccgtctgtatggcg
agaagcggctgtagtccatttccaatgtgctgggctgaagaatatgacagatacctagca
tctagcaaaataatggcagctgcttaccttgacccaaacttgaatcacacgccaaattcg
agtactaagactcacctgggtactggtatggaacgttctcctgggacaatggagcgagta
ttaaaggtctttcattattttgaaagcaatagtgaaccaaccacatgggccagtattatc
agacatggagatgctactgatgtcaggggcatcattcagaagatagtggacagtcacaaa
gtaaagcacgtggcctgctatggattccgcctcagtcacctgctgtcggaggaggttcac
tggctccatttggatatgggtgtttccaatgtgagggagaagtacgaacttgcacacccc
ccagaggagtggaaatatgaattgagaattcgttatttgccaaaaggatttctaaaccag
tttactgaagataagccaactttgaatttcttctatcaacaggtgaagagcgattatatg
ttagagatagctgatcaagtggaccaggaaattgctttgaagttgggctgtctagaaata
cggcgctcatactgggagatgcggggcaacgcgctggaaaagaagtctaactatgaagta
ttagaaaaagatgttggtttaaagcgatttttccctaagagtttactggattctgtcaag
gccaaaacactaagaaaactgatccaacagacgtttagacaatttgccaaccttaataga
gaagaaagtattctgaaattctttgagattctctcccctgtgtacagatttgataaagaa
tgcttcaaatgtgctcttggttcaagctggattatttcagtggaactggcaatcggccca
gaagaaggcatcagttacctaacggacaagggctgcaaccctacacatctggccgacttt
aaccaagtgcagaccatccagtattcaaacagcgaagacaaggacagaaaaggaatgcta
cagctaaaaatagcaggcgcacccgagcctctgacagtgacggccccatccttaaccatt
gcagagaatatggctgacttgatcgatggctactgccggctggtgaatggagccacgcag
tctttcatcatcagaccccagaaagaaggtgaacgggctttaccatcaataccaaagctc
gccaacagcgagaagcagggcgtgcggacccacgctgtctccgtgtcagagacagacgac
tatgctgagattatagatgaagaagatacgtacaccatgccctccaccagggattatgag
attcaaagagaaagaatagaacttggacgatgtattggagaaggccagttcggagatgta
catcaaggagtgtatatgagtccggagaatccagctttggcggttgcaattaaaacgtgt
aaaaactgtacttcggacagcgtgagagagaaattccttcaagaagccttaacaatgcgt
cagtttgaccatcctcacatcgtgaagctgattggtgtcatcacggagaatcccgtctgg
ataatcatggagctgtgcacgcttggggagctgaggtcatttttgcaaatgaggaaatac
agtttggatctggcgtctttgattctgtatgcctaccaactgagtacagctcttgcatat
ctagagagcaaaagatttgtacacagggacattgctgctcggaacgttctggtgtcttcg
cctgattgtgtaaaactaggagactttgggttatcccggtgcatggaagacagcacctac
tacaaagcttccaaaggaaaattgccgattaagtggatggctccagagtccatcaatttt
cgacgttttacctcagctagtgatgtgtggatgtttggtgtgtgtatgtgggagattttg
atgcatggtgtgaagccttttcaaggagtgaagaacaatgatgtgatcggtcggattgaa
aatggggagagattaccaatgcctccaaattgtcctcctaccctctacagccttatgacg
aagtgctgggcctatgaccccagcaggcggcccaggtttactgaacttaaagcgcagctc
agcacaatcctggaggaagagaaggttcagcaagaagagcgcatgagaatggagtccaga
agacaggtcacagtgtcctgggactctggagggtccgatgaagcacctcccaagcccagc
agacctggttatcccagtccgaggtcaagtgaaggattttatcccagcccacagcacgtg
gtacaaaccaatcattaccaggtctctggctaccctggctcccatggaatcacagccatg
gctggcagcatctacccgggccaggcctctcttctggaccaaacagactcgtggaatcac
agacctcaggaggtatcaatgtggcagcccaacgtggaggactctgcagcattggacatg
cgaggaattgggcaggtactgccagcccacctgatggaagagcggctgatccgacagcaa
caggagatggaagaagaccagcgctggctggagaaagaggagagattcctgaagccggac
gtgaggctctctcggggcagcatcgacagggaggacggaggtctccaaggcccgactgga
aaccaacacatatatcagcctgtgggtaagccagatcctgcagctccaccaaagaaaccc
ccgcgccctggagcccccagccacctgggcagccttgccagcctcagcagccctggggac
agctacaacgagggcgtcaagctccagccccaggagatcagccctccgcccacggccaat
ctcgaccgctccaacgacaaggtgtacgagaacgtcactggcctagtgaaagctgtcatt
gagatgtccagtaaaatccagccggccccgccagaggagtacgtgcctatggtgaaggaa
gtcggcttggccctgaggacattactggcgactgtggatgagaccattcccgtcctgcca
gccagcacacaccgagagattgagatggcccagaagctgctgaactccgacctagggggg
ctcatcaacaagatgaagctggcccagcagtacgtcatgaccagcctccagcaggagtac
aagaagcaaatgctgaccgctgcgcatgccctggccgtggatgccaaaaacctgctggac
gtcattgaccaagcaagactgaaaatgctggcgcagacgagaccgcactga

DBGET integrated database retrieval system