KEGG   Loxodonta africana (African savanna elephant): 100668441
Entry
100668441         CDS       T04351                                 

Gene name
RASSF1
Definition
(RefSeq) ras association domain-containing protein 1 isoform X1
  KO
K09850  Ras association domain-containing protein 1
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04014  Ras signaling pathway
lav04390  Hippo signaling pathway
lav04392  Hippo signaling pathway - multiple species
lav05200  Pathways in cancer
lav05206  MicroRNAs in cancer
lav05219  Bladder cancer
lav05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100668441 (RASSF1)
   04390 Hippo signaling pathway
    100668441 (RASSF1)
   04392 Hippo signaling pathway - multiple species
    100668441 (RASSF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100668441 (RASSF1)
   05206 MicroRNAs in cancer
    100668441 (RASSF1)
  09162 Cancer: specific types
   05219 Bladder cancer
    100668441 (RASSF1)
   05223 Non-small cell lung cancer
    100668441 (RASSF1)
SSDB
Motif
Pfam: RA Nore1-SARAH DUF5111 Mst1_SARAH
Other DBs
NCBI-GeneID: 100668441
NCBI-ProteinID: XP_003410137
LinkDB
Position
Unknown
AA seq 272 aa
MGEADAGTPSFEMTWSSTTSSGYCSQEDSDSELEQYFTARTSLARRPRRDQDEPVEWETP
DLSQAEIEQKIKEYNSQINSNLFMSLNKDGSYTGFIKVQLKLVRPVSVPASKKPPSLQDA
RRSPVRGTAVRRRTSFYLPKDAVKHLHVLSRTRAREVIEALLRKFLVVDDPRKFALFERA
ERHGQVYLRKLSDDEQPLRLRLLAGPSEKALSFVLKENDSGEVNWDAFSMPELHNFLRIL
QREEEEHLRQILQKYSCCRQKIQEALHACPLG
NT seq 819 nt   +upstreamnt  +downstreamnt
atgggcgaggcggacgcggggacgccttctttcgagatgacttggagcagcacgacaagc
agcggttactgcagccaggaggactcagactcggagctcgagcagtacttcacggcgcgc
acctcgctggctcgcaggccgcgacgggatcaggatgagcccgtggagtgggagacacct
gacctttctcaggctgagattgagcagaagatcaaggagtacaacagccagatcaatagc
aacctctttatgagcttgaacaaggacggttcctacacaggcttcatcaaggttcagctg
aagctggtgcgccctgtctcagtgcctgccagcaagaagccaccctccctgcaggatgcc
cgacgtagcccagtgcggggcactgctgtgaggcgtcgcacctccttctacctgcctaag
gatgctgtcaaacacctgcacgtgctgtcacgcacacgagcacgtgaggtcattgaggcc
ctgctgcgcaagttcttggtagtggatgacccccgcaagtttgcactttttgagcgggca
gagcgccacggccaagtgtatctgcggaagctgtcggatgatgaacagcccctgcggctg
cggctccttgcaggacccagtgagaaggccctgagctttgtcctaaaggagaacgactct
ggggaggtgaattgggatgccttcagcatgccggaactacacaactttctgcgcatcctg
cagcgagaggaggaggagcaccttcgccagatcctgcagaagtactcctgttgccgccag
aagatccaggaggctctgcatgcctgccctctggggtga

DBGET integrated database retrieval system