KEGG   Loxodonta africana (African savanna elephant): 100668529
Entry
100668529         CDS       T04351                                 

Gene name
CDK1
Definition
(RefSeq) cyclin-dependent kinase 1 isoform X1
  KO
K02087  cyclin-dependent kinase 1 [EC:2.7.11.22 2.7.11.23]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04110  Cell cycle
lav04114  Oocyte meiosis
lav04115  p53 signaling pathway
lav04218  Cellular senescence
lav04540  Gap junction
lav04914  Progesterone-mediated oocyte maturation
lav05170  Human immunodeficiency virus 1 infection
lav05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:lav00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100668529 (CDK1)
   04114 Oocyte meiosis
    100668529 (CDK1)
   04115 p53 signaling pathway
    100668529 (CDK1)
   04218 Cellular senescence
    100668529 (CDK1)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100668529 (CDK1)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    100668529 (CDK1)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100668529 (CDK1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100668529 (CDK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lav01001]
    100668529 (CDK1)
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:lav03032]
    100668529 (CDK1)
   03036 Chromosome and associated proteins [BR:lav03036]
    100668529 (CDK1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lav04147]
    100668529 (CDK1)
Enzymes [BR:lav01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     100668529 (CDK1)
    2.7.11.23  [RNA-polymerase]-subunit kinase
     100668529 (CDK1)
Protein kinases [BR:lav01001]
 Serine/threonine kinases: CMGC group
  CDK family
   100668529 (CDK1)
DNA replication proteins [BR:lav03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Prevention of re-replication factors
    100668529 (CDK1)
Chromosome and associated proteins [BR:lav03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    100668529 (CDK1)
Exosome [BR:lav04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100668529 (CDK1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Haspin_kinase Kinase-like Kdo Seadorna_VP7 Choline_kinase
Other DBs
NCBI-GeneID: 100668529
NCBI-ProteinID: XP_003409326
UniProt: G3UC20
LinkDB
Position
Unknown
AA seq 297 aa
MEDYTKIEKIGEGTYGVVYKGRHKTTGQIVAMKKIRLESEEEGVPSTAIREISLLKELRH
PNIVSLQDVLMQDSRLYLIFEFLSMDLKKYLDSIPPGQFMDSALVKSYLYQILQGIVFCH
SRRVLHRDLKPQNLLIDDKGTIKLADFGLARAFGIPIRVYTHEVVTLWYRSPEVLLGSAR
YSTPVDIWSIGTIFAELATKKPLFHGDSEIDQLFRIFRALGTPNNEVWPEVESLQDYKNT
FPKWKPGSLASHVKNLDENGLDLLSKMLVYDPAKRISGKMALNHPYFNDLDNQIKKM
NT seq 894 nt   +upstreamnt  +downstreamnt
atggaagactataccaaaatagagaaaattggggaaggtacctatggagttgtgtataag
ggtagacacaaaactacaggtcagattgtagccatgaagaaaatcagactagaaagtgaa
gaagaaggggttcctagtactgcaattcgagaaatttctctgttaaaggaacttcgtcat
ccaaatatagtcagtcttcaagatgtgcttatgcaggactccaggttatatctcatcttt
gaattcctttccatggatctcaaaaaatacttggattctatccctcctggtcagttcatg
gattctgcacttgttaagagttatttgtaccaaatcctacagggcattgtgttttgtcac
tctagaagagttcttcacagagacttaaaacctcagaatctactgattgatgacaaagga
acaatcaaactggctgattttggccttgccagagcttttggaatacctattagagtatat
acacatgaggtagtaactctctggtatagatctccagaagtattgctggggtcagctcgc
tattcgactccagttgacatttggagtataggcaccatatttgcagaattagcaactaag
aaaccacttttccatggggattcagaaattgatcaactcttcagaattttcagagctttg
ggtactcccaataatgaagtgtggccagaagtggaatctttacaggactataagaataca
tttcccaagtggaaaccgggaagcctagcatcccatgtcaaaaacttggatgaaaatggc
ttggatttgctctcgaaaatgttagtctatgatcctgccaaacggatttctggcaaaatg
gcactgaatcatccatactttaatgatttggacaatcagattaagaagatgtag

DBGET integrated database retrieval system