KEGG   Loxodonta africana (African savanna elephant): 100668572
Entry
100668572         CDS       T04351                                 

Gene name
NPY1R
Definition
(RefSeq) neuropeptide Y receptor type 1
  KO
K04204  neuropeptide Y receptor type 1
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04024  cAMP signaling pathway
lav04080  Neuroactive ligand-receptor interaction
lav04923  Regulation of lipolysis in adipocytes
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    100668572 (NPY1R)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100668572 (NPY1R)
 09150 Organismal Systems
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    100668572 (NPY1R)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:lav04030]
    100668572 (NPY1R)
G protein-coupled receptors [BR:lav04030]
 Rhodopsin family
  Peptide
   Neuropeptide Y
    100668572 (NPY1R)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx Git3
Other DBs
NCBI-GeneID: 100668572
NCBI-ProteinID: XP_003418535
UniProt: G3SP89
LinkDB
Position
Unknown
AA seq 382 aa
MNSTVSSQVENHSVDYNFSEKSSQLLAFENDDCHLPLAMIFTLALAYGAVIILGVSGNLA
LIIIILKQKEMRNVTNILIVNLSFSDLLVAIMCLPFTFVYTLMDHWVFGEAMCKLNPFVQ
CVSITVSIFSLVLIAVERHQLIINPQGWRPNNRHAYLGIAVIWVVAVASSLPFLIYQVLT
DEPFQNVTLDAFKDKYVCFDKFPSDSHRLSYTTLLLVLQYFGPLCFIFICYFKIYIRLKR
RNTMMDKMRDNKYRSSETKRINIMLLSIVVAFAVCWLPLTIFNTVFDWNHQIIATCNHNL
LFLLCHLTAMISTCVNPIFYGFLNKNFQRDLQFFFNFCDFRSRDDDYETIAMSTMHTDVS
KSSLKQASPVGFKKIDDDNEKI
NT seq 1149 nt   +upstreamnt  +downstreamnt
atgaactcgacagtatcttcccaggtagaaaatcattcagtggattataatttttcagag
aagagttcacagcttttagcttttgaaaatgatgattgccatctgcccttggccatgata
tttacattagctcttgcttatggagctgtgataattcttggggtctctggaaacctggct
ttgatcataatcatcttgaaacaaaaggagatgagaaatgttaccaacatcctgattgtg
aacctttccttctcagacttgcttgttgccatcatgtgtctccccttcacctttgtctac
acactgatggaccactgggtctttggtgaggcgatgtgcaagttgaatccttttgtgcaa
tgtgtttccatcactgtgtctattttctccctggtcctcatcgctgtggaacggcatcag
ctgataatcaacccacaagggtggcgaccaaataatagacatgcttatttaggtatcgct
gtcatctgggttgttgccgtggcttcttctctgcccttcctgatctatcaagtcttgacc
gatgaaccattccaaaatgtgacacttgatgcgttcaaggacaagtatgtgtgctttgat
aaattcccatcggactctcacaggttgtcatataccactctcctgttggtactgcagtat
tttggcccgctctgttttatatttatttgctactttaagatatatatacgcttaaaaagg
agaaacaccatgatggacaagatgagagataataagtacaggtccagtgaaaccaaaaga
atcaatatcatgttgctgtccatcgtggttgcatttgcagtctgctggctgcctctcacc
atctttaacactgtgtttgattggaatcatcagatcattgctacgtgcaaccataacctg
ttattcctgctctgccacctcacagcaatgatttccacctgtgtcaatcccatattttat
ggattcctgaacaaaaacttccagagggacttgcagttcttctttaacttttgtgatttc
cggtctcgggatgatgactatgagacaattgccatgtccaccatgcacacagatgtttct
aagtcttctttgaaacaagccagcccagttgggtttaaaaaaatcgatgatgataatgaa
aaaatctga

DBGET integrated database retrieval system