KEGG   Loxodonta africana (African savanna elephant): 100668635
Entry
100668635         CDS       T04351                                 

Gene name
FGF23
Definition
(RefSeq) fibroblast growth factor 23
  KO
K22428  fibroblast growth factor 23
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04010  MAPK signaling pathway
lav04014  Ras signaling pathway
lav04015  Rap1 signaling pathway
lav04020  Calcium signaling pathway
lav04151  PI3K-Akt signaling pathway
lav04810  Regulation of actin cytoskeleton
lav04928  Parathyroid hormone synthesis, secretion and action
lav05200  Pathways in cancer
lav05218  Melanoma
lav05224  Breast cancer
lav05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100668635 (FGF23)
   04014 Ras signaling pathway
    100668635 (FGF23)
   04015 Rap1 signaling pathway
    100668635 (FGF23)
   04020 Calcium signaling pathway
    100668635 (FGF23)
   04151 PI3K-Akt signaling pathway
    100668635 (FGF23)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100668635 (FGF23)
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    100668635 (FGF23)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100668635 (FGF23)
  09162 Cancer: specific types
   05226 Gastric cancer
    100668635 (FGF23)
   05218 Melanoma
    100668635 (FGF23)
   05224 Breast cancer
    100668635 (FGF23)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:lav04052]
    100668635 (FGF23)
   00536 Glycosaminoglycan binding proteins [BR:lav00536]
    100668635 (FGF23)
Cytokines and growth factors [BR:lav04052]
 Growth factors
  Growth factors (RTK binding)
   100668635 (FGF23)
Glycosaminoglycan binding proteins [BR:lav00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   100668635 (FGF23)
SSDB
Motif
Pfam: FGF
Other DBs
NCBI-GeneID: 100668635
NCBI-ProteinID: XP_003410677
UniProt: G3THV7
LinkDB
Position
Unknown
AA seq 251 aa
MLGARLRLWVCTLCSACSMCSVRAYPNASPLLHSSWGGLTHLYTATARNSYHLQIHKDGH
VDGTPDQTIYSALIIRSEEAGFVVITGVMSRRYLCMDFRGNIFGSHYFNPENCRFKHWTL
ENGYDVYHSPQHHFLVSLGRVKKAFLPGMNPPPYSQFLSRRNEIPLIYFNTPKPRRHTRS
AEDDSERDPLNVLKPRPRMTPAPASCSQELLSAEDNSVVANDPLGVVRSNRVNTHAGGIG
VERCRPFPKFI
NT seq 756 nt   +upstreamnt  +downstreamnt
atgttgggggcccgcctcaggctctgggtctgcaccctgtgcagtgcctgcagcatgtgc
agtgtcagagcctatcccaatgcctccccgctgctccactccagctggggtggcctgacc
cacctgtacacagccaccgccaggaacagctaccacctgcagatccacaaggacggccat
gtggatggtacgccggaccagaccatctacagtgccctgataatcagatcagaggaggcc
ggcttcgtggtgattacaggggtgatgagtaggagatacctctgtatggatttcagaggc
aacatttttggatcgcattacttcaacccagagaactgcaggttcaaacactggacgctg
gaaaatggatatgacgtctatcactctcctcagcatcatttcctggtcagtctgggtcgc
gtgaagaaggccttcctgccaggcatgaacccaccaccttactctcagttcctgtcccgg
aggaatgagatccccttgatttacttcaacacccccaagccccggcggcacacccggagt
gccgaggatgactctgaacgggacccactgaatgtgctgaagccccggccccgtatgaca
cctgctccagcttcttgctcccaggaactcctgagtgctgaagacaacagcgtggtggcc
aatgaccctttaggagtggtcagaagcaatagggtcaacacacatgctggtgggataggt
gtggaaaggtgccgccccttccccaagttcatctag

DBGET integrated database retrieval system