KEGG   Loxodonta africana (African savanna elephant): 100668716
Entry
100668716         CDS       T04351                                 

Gene name
TRAF3
Definition
(RefSeq) TNF receptor-associated factor 3
  KO
K03174  TNF receptor-associated factor 3
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04064  NF-kappa B signaling pathway
lav04620  Toll-like receptor signaling pathway
lav04621  NOD-like receptor signaling pathway
lav04622  RIG-I-like receptor signaling pathway
lav04657  IL-17 signaling pathway
lav04668  TNF signaling pathway
lav05160  Hepatitis C
lav05161  Hepatitis B
lav05162  Measles
lav05164  Influenza A
lav05165  Human papillomavirus infection
lav05167  Kaposi sarcoma-associated herpesvirus infection
lav05168  Herpes simplex virus 1 infection
lav05169  Epstein-Barr virus infection
lav05171  Coronavirus disease - COVID-19
lav05200  Pathways in cancer
lav05203  Viral carcinogenesis
lav05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    100668716 (TRAF3)
   04668 TNF signaling pathway
    100668716 (TRAF3)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100668716 (TRAF3)
   04621 NOD-like receptor signaling pathway
    100668716 (TRAF3)
   04622 RIG-I-like receptor signaling pathway
    100668716 (TRAF3)
   04657 IL-17 signaling pathway
    100668716 (TRAF3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100668716 (TRAF3)
   05203 Viral carcinogenesis
    100668716 (TRAF3)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    100668716 (TRAF3)
  09172 Infectious disease: viral
   05161 Hepatitis B
    100668716 (TRAF3)
   05160 Hepatitis C
    100668716 (TRAF3)
   05171 Coronavirus disease - COVID-19
    100668716 (TRAF3)
   05164 Influenza A
    100668716 (TRAF3)
   05162 Measles
    100668716 (TRAF3)
   05168 Herpes simplex virus 1 infection
    100668716 (TRAF3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100668716 (TRAF3)
   05169 Epstein-Barr virus infection
    100668716 (TRAF3)
   05165 Human papillomavirus infection
    100668716 (TRAF3)
SSDB
Motif
Pfam: zf-TRAF zf-C3HC4 zf-C3HC4_2 MIP-T3_C HlyD_2
Other DBs
NCBI-GeneID: 100668716
NCBI-ProteinID: XP_023402422
LinkDB
Position
Unknown
AA seq 584 aa
MEPSKKMDPPGSLQTNPPLKPTSDRSAGAAGFVPEQGGYKEKFVKTVEDKYKCEKCRLVL
CNPRQTECGHRFCETCMAALLSSASPKCTACQESIVKDKVFKDNCCKREILALQIYCRNE
SRGCAEQLTLGLLLVHLKNDCQFEELPCVRADCKEKVLRKDLCDHVEKACKYREATCNHC
KSQVPMITLQKHEDTECPCVVVSCPHKCSVQTLLRSELSAHLSECVNAPSTCSFKRYGCV
FQGTNQQIKAHEASSAVQHVNLLKEWSNSLEKKVSLLQNESVEKNKSIQSLHNQICSFEI
EIERQKEMLRNNESKILHLQVRCFRLWLDHQVEEHVFCFLHLTGGERSWLSVAQKAPIEG
LHLLDSWGVDSTAMRPSEDVHHPELETSMSDLCTGLLESQLSRHDQMLSVHDIRLADMDL
RFQVLETASYNGVLVWKIRDYRRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDG
MGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHLGDAFKPDPNSSSFKKP
TGEMNIASGCPVFVAQTVLENGTYIKDDTIFIKVIVDTSDLPDP
NT seq 1755 nt   +upstreamnt  +downstreamnt
atggagcccagtaaaaagatggaccccccaggctccctgcagaccaaccccccgctgaag
ccgacttctgaccgcagtgctggggcagccgggtttgtccccgagcaagggggctacaag
gagaagtttgtgaagaccgtggaggacaagtacaagtgcgaaaagtgccgccttgtcctg
tgcaacccgaggcagacggagtgtggacaccggttctgtgagacctgcatggctgccctg
ctgagctccgctagtccgaagtgtactgcgtgtcaagaaagcatcgttaaagataaggtg
tttaaggacaattgctgcaagagagagatcctagctcttcagatctattgtcggaatgaa
agccggggctgtgcagaacagctaaccctggggcttctgctggtacatttaaaaaatgat
tgccaatttgaagaacttccatgtgtccgtgctgactgcaaagaaaaagtattgagaaaa
gacctctgtgaccacgtggaaaaggcctgtaaataccgcgaggccacgtgcaatcactgt
aaaagccaggttccaatgatcaccttgcagaaacacgaggacactgagtgcccctgcgtg
gtggtttcctgtccccataagtgtagcgtccagacacttctgaggagcgagttgagtgca
cacttgtcagagtgtgtcaatgcccccagcacctgtagttttaagcgttatggctgcgtt
tttcagggaacaaaccagcagattaaggcacacgaggccagctctgcagtgcagcacgtg
aacttactgaaggaatggagcaattctctggagaagaaggtttccttgctgcagaatgaa
agcgtagagaaaaacaagagcattcaaagcttgcacaatcagatctgtagcttcgaaatt
gaaattgagagacaaaaggaaatgcttcgaaataatgaatccaagatacttcacttacag
gtaagatgcttcaggctgtggctggatcaccaggtagaggaacacgtcttctgttttctc
catttgactggtggggagaggtcctggctgtcagtggcccagaaagcaccaattgagggc
ctccacctgctggactcttggggtgtcgactcgaccgccatgcggccctcagaggatgtc
caccatcctgaacttgagacctcgatgagcgacctctgcactggcttgctggagtcgcag
ctgagccggcacgaccagatgctgagcgtccatgacatccgcctggctgacatggacctg
cgcttccaggttctggagaccgccagctacaacggcgtgctggtctggaagattcgtgac
tacaggcggcggaagcaggaggccgtcatgggcaagaccctgtctctctacagccagccc
ttctacaccggctactttggctataagatgtgtgccagggtctatctgaacggggacgga
atgggcaaggggacgcacttgtcactgttttttgtcattatgcgtggagagtatgacgct
ctgctcccttggccattcaagcagaaagtgacgctcatgttgatggaccaggggtcctct
cggcgccatctgggagacgcattcaagcccgaccccaacagcagtagcttcaagaagccc
actggagagatgaatattgcttctggctgcccagtctttgtggcccaaactgttctagaa
aacgggacatatattaaagatgatacgatttttattaaagtcatagtggatacttcagat
ctgcccgacccctga

DBGET integrated database retrieval system