KEGG   Loxodonta africana (African savanna elephant): 100668730
Entry
100668730         CDS       T04351                                 

Gene name
CCKBR
Definition
(RefSeq) gastrin/cholecystokinin type B receptor isoform X1
  KO
K04195  cholecystokinin B receptor
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04020  Calcium signaling pathway
lav04080  Neuroactive ligand-receptor interaction
lav04971  Gastric acid secretion
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    100668730 (CCKBR)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100668730 (CCKBR)
 09150 Organismal Systems
  09154 Digestive system
   04971 Gastric acid secretion
    100668730 (CCKBR)
G protein-coupled receptors [BR:lav04030]
 Rhodopsin family
  Peptide
   Cholecystokinin
    100668730 (CCKBR)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4 7TM_GPCR_Srh 7TM_GPCR_Srx
Other DBs
NCBI-GeneID: 100668730
NCBI-ProteinID: XP_003412106
LinkDB
Position
Unknown
AA seq 449 aa
MELLRLNRSVPGPGPGSGASLCRPGGLLLNGSSASNLSCESPRIRGAGTRELELAIRITL
YVVIFLMSVGGNVLIIVVLGLSRRLRTVTNAFLLSLAVSDLLLAVACMPFTLLPNLMGTF
IFGTVVCKAVSYLMGVSVSVSTLSLVAIALERYSAICRPLQARVWQTRSHAARVIVATWL
LSGLLMVPYPVYTAVQPAGPRVLQCVHRWPSARVRQTWSVLLLLLLFFVPGVVMAVAYGL
ISRELYLGLRFDGDSDSDSQSRVRSQGGLQDPAQRNGHCRIETGLAGEDGDGCYVQLPRS
RPALELSALTAPTSGPGHGPQPVQAKLLAKKRVVRMLLVIVVLFFLCWLPVYSANTWRAF
DGPGAHRALSGAPISFIHLLSYASACVNPLVYCFMHRRFRQACLETCSRCWPRPPRARPR
PLPDEDPPTPSIASLSRLSYTTISTLGPG
NT seq 1350 nt   +upstreamnt  +downstreamnt
atggagctgctgaggctgaaccggagcgtgccgggacccggacctgggtcgggggcttct
ctgtgccgcccagggggcctcctcctcaacggcagcagtgccagcaacctcagctgcgag
tccccacgcatccgcggagccgggacacgagaattggagctggccattagaatcaccctt
tatgtcgtgatctttctgatgagcgttggaggaaatgtgctaatcatcgtggtcctgggg
cttagccggcgcctgcggacggtcaccaatgccttcctgctctctctcgcagtcagcgac
ctcctgctggctgtggcttgcatgcccttcaccctcctgcccaatctcatgggcacattc
atctttggcacagtcgtctgcaaggcagtttcctacctcatgggggtatctgtgagtgtg
tccacactaagcctcgtggccatcgccctggaacggtacagcgccatctgtcggccactg
caggcgcgtgtatggcagacgcgctcccacgcggctcgcgtgattgtagccacatggttg
ctgtccgggctgctcatggtgccctaccccgtgtacaccgccgtgcagccagcagggccc
cgtgtgctacagtgtgtgcatcgctggcccagtgcgcgcgtccgccagacctggtcggtg
ctgctgctcctgctcttgttcttcgtcccgggtgtggttatggctgtggcctacgggcta
atctcccgcgagctctacctggggcttcgctttgacggtgacagtgacagcgacagccag
agccgggtccgaagccaaggagggctgcaggatccagcccaacggaacggacattgccgg
atcgagactgggctggctggcgaggacggcgatggctgctacgtgcagcttccacgctcc
cggcctgcactggagctgtcggcgctgacggcgcccacttctgggccaggacacggcccc
cagccggtccaggcaaagttgttggccaagaagcgagtggtgcgaatgttgctggtgatc
gttgtgctttttttcctgtgttggctgccagtgtacagtgccaacacgtggcgcgccttc
gatggtcctggtgcgcaccgcgcactctcgggtgcaccgatctccttcatccacttgctg
agctatgcctccgcctgtgtcaatcccctggtctactgcttcatgcaccgtcgctttcgt
caagcctgcctcgaaacttgctcccgctgctggccccgccctccacgagctcgccccagg
cctctcccagacgaggaccctcccaccccttccattgcttcgctctccaggctgagctac
accaccatcagcactctggggccgggctga

DBGET integrated database retrieval system