KEGG   Loxodonta africana (African savanna elephant): 100668880Help
Entry
100668880         CDS       T04351                                 

Gene name
POLRMT
Definition
(RefSeq) DNA-directed RNA polymerase, mitochondrial isoform X1
  KO
K10908  DNA-directed RNA polymerase, mitochondrial [EC:2.7.7.6]
Organism
lav  Loxodonta africana (African savanna elephant)
Brite
KEGG Orthology (KO) [BR:lav00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:lav03029]
    100668880 (POLRMT)
Enzymes [BR:lav01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.6  DNA-directed RNA polymerase
     100668880 (POLRMT)
Mitochondrial biogenesis [BR:lav03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial RNA polymerase
    100668880 (POLRMT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RNA_pol RPOL_N PPR_3 PPR_2
Motif
Other DBs
NCBI-GeneID: 100668880
NCBI-ProteinID: XP_010600150
LinkDB All DBs
Position
Unknown
AA seq 1236 aa AA seqDB search
MSALSWGRGAAGLGRVLVPAGRPGLVADAGAGALGGIWGRRRSSSASPCERDRRKDWGHA
ELLEVLEARVRQLQAESVSEVTVKRVDVTRIPEGSGGSFQSSRKAKAGAAPELRGRWAEK
LDKEKWIMQKRKQQLEVKLKAHMQKLPRERQLRPLRVEPRLQNGQLAGCLQRWARGSPDS
PWEKQLAQALQETPRKLSREEAQALANREAKAQLSGQQQKLLAFLKCCLLTDHVPLAHHV
LVTQHGNFRRRRQLTLAMYNTVMLGWARKGSFKELVYVFFMVKDAGLTPDLLSYAAALQC
MGRLDQDAETIKRCLEQMARDRLQLQKLFSAVPMSRDEQAALLTAVRKVKPAFSPPPRPA
PQVNISPLLRDVYAQGRPVSYPKLHLPLKTLEDLFQQQLRVELATTVQVQSVDKAPPLTS
EVLHARETLRSLQAQWEAALCQELQEIKANLARTAHGGRPTLYPHLCLLSERQMAQMLLQ
VLQVLPPQGESLIHLAHELGMRTFNRYVVQRKQREHQVQALQRRYSEYLRLLACDTQVDP
PRLPRQHWEMLGGPGGEPPPEQPWPLPVLLQLGKQLAEVLVRAVHMPRNLGAPAGKGAGT
EPLIPVLYHVYSFRSVRQIGILKPHPAFSQLLAAAAEPTLTFEAAEVPMLCPPLPWTSPH
SGAFLLSPAKLMRAVEGTMLHQQRLEHCPPAALHGAFDALTQLGNCAWRVNGRVLDLVLE
LFHAHGCTRLGVPPPASDAPCPPARRPPPGTPPARLAELRREVARCLKAARELRSLRADA
LYRLSLAQHLRHHGAFWLPHNMDFRGRTYPCPPHLSHLGSDLARALLEFAQGCPLGPHGL
DWLKLHLVNLTGLKKRESLQARLAFADQVLDEVLDSADRPMTGRKWWMEADEPWQTLACC
MELARALRSPDPTSFVSHFPVHQDGSCNGLQHYAALGRDSVGAASVNLTPSDLPQDVYSG
VAAQVEVFRRQDAEQGVRVAQVLEGFVSRKVVKQTVMTVVYGVTRYGGRLQIEKRLRELP
DFPQEFVWEASHYLVRQVFNSLQEMFSATRAIQHWLTESARLISHTGSAVEWVTPLGIPI
IQPYHRISKFLIKGGIQSMTFNHSSDSSQRPNTLKQKNGFPPNFIHSLDSSHMMLTALHC
YRKGLTFVSVHDCFWTHAADVPVMNQVCREQFVRLHSQPILRDLSRFLVKRFCSAPRSQN
LSKNAQTRKLFETLLALPETGDFDLEQVKQSTYFFS
NT seq 3711 nt NT seq  +upstreamnt  +downstreamnt
atgtcggcgctcagctggggccgcggggcggcggggctcgggcgggtcctggtgcccgcc
ggccgccccgggctcgtggccgacgcaggggcaggggcccttggtggcatctggggccgc
agaaggagctcgtctgccagcccttgtgagcgagaccgccggaaggactggggccacgcg
gagctgctggaagtgctggaggcacgggtgcggcagctgcaggctgagtctgtgtcagag
gtgacggtgaagagggtggatgtgactcggatcccagagggcagtggtggcagcttccag
tcatccaggaaggccaaggcaggggctgccccggagctccgtggccgctgggcagagaaa
ctggacaaagagaagtggattatgcagaagcgcaagcagcagctggaggtgaagctgaag
gcccacatgcagaagttgccccgggagaggcagctgaggccgctgcgtgtggagccgcgg
ctacagaacgggcagctggccggctgcctgcagcggtgggcgcgagggagtcctgacagc
ccttgggagaagcagctggctcaggccctacaggagaccccaaggaagctgagccgtgaa
gaggcacaggccctggccaatagggaggccaaggcacagctctcgggccagcagcagaag
ctcctggccttcttgaagtgctgcctgctcacagaccatgtgccccttgcccaccacgtg
ctagtcacccagcatggcaatttccggcggcggcggcagctcacgctcgccatgtacaat
actgtcatgcttggctgggcccgcaagggctccttcaaggaattggtctatgtgttcttc
atggtgaaggatgctggcctcacccccgatctgctgtcctacgcagctgctctccagtgc
atggggcggctggaccaggatgccgaaaccatcaaaaggtgtctggagcagatggcccgg
gaccggctgcagctgcagaagctcttctcggccgtgcccatgtccagggatgagcaggct
gcactcctgacagctgtgcggaaggtcaagcctgccttcagcccaccgccacggcctgcg
ccccaggtcaacatttcgccgctgctcagggatgtctacgcccagggcaggcctgtgtcc
tacccgaagctgcacctgcccctgaagacactggaggacctcttccagcagcagctgcgc
gtggagctggccaccaccgttcaggtccagtcagtggacaaggccccgccactgaccagc
gaggttctgcatgcgcgggagactctgaggagcctgcaggcccagtgggaggcggcgctg
tgccaggagctgcaggagatcaaagccaacctggcgcgcacagcccacggaggacgcccc
acgctctacccgcacctgtgcctgctgagtgagcggcagatggcgcagatgctgctgcag
gtgctgcaggtactgcccccccagggcgagtctctgatccacctggcgcatgagctgggc
atgcggaccttcaaccggtatgtggtgcagcggaagcagcgggagcaccaggtgcaggcg
ctgcagaggcgctactcagagtacctgcgcctgctggcctgcgacacccaggtggacccg
ccccgtctgccacgccagcactgggagatgctggggggtccgggcggcgagcccccaccc
gagcagccgtggcctctgccggtgctgctgcagctggggaagcagttggcggaggtgctg
gtgcgggctgtgcacatgccgcgtaacctgggcgcacccgccgggaagggggccgggacc
gagccgctcatcccggtgctctaccatgtgtactccttccgcagcgtccgccagattggc
atcttgaagccacatccggccttctcgcagctcctggcggcggcggcagagcccacactg
accttcgaggcagccgaggtgcccatgctgtgccccccactgccctggacctcaccacac
tcgggggccttcctgctgagccccgccaagctgatgcgggctgtggagggcaccatgctg
caccagcagcggcttgagcactgcccgcccgccgcgctgcacggtgccttcgacgccctc
acccagctgggcaactgcgcctggcgtgtcaacgggcgcgtgctcgacctggtgttagag
ctattccacgcacacggctgcacccgcctaggcgtgccgcccccggcctccgatgcaccg
tgcccacctgcccgccgtcctccacccggcaccccgcccgctcgcctggctgagctgcgg
cgggaggtggcgcgctgcctaaaggcagcccgggagctgcgcagcctgcgtgccgacgct
ctctaccgtctctcgctggcccagcacctgcggcaccacggtgccttctggctgccccac
aacatggacttccgaggccgcacttacccctgcccaccgcacctcagccacctgggcagt
gacctggcccgagccctgcttgagttcgcccagggctgcccccttggcccccatggcctg
gactggctcaagctccacctggttaacctcaccggcctcaagaagcgcgagtcgctgcag
gcacgtctggcttttgcagaccaggtgctggacgaggtcttggactcagctgaccggccc
atgacgggccgaaagtggtggatggaggcggacgagccttggcagaccctggcctgctgc
atggagctcgcgagggccctgcgttcccctgaccccaccagctttgtctcccacttcccg
gtccaccaggatggctcctgtaacggcctgcagcactatgccgccctgggccgagacagc
gtgggcgccgcctctgtcaacctgacaccttcagacctgcctcaggatgtatacagtggg
gtagctgcacaggtggaggtgttccgcaggcaggatgcggagcagggcgtccgtgtggcc
caggtgctcgagggcttcgtgagccgcaaggtggtgaagcagacagtcatgactgtggtg
tacggggtcacccgctacggtggacgcctgcagattgagaagcgcctccgcgagctgcct
gacttcccccaggagttcgtgtgggaggcttcccactacctggtgcggcaagtcttcaac
agcctccaggagatgttctccgcgacccgagccatccagcactggctgacagaaagtgcc
cgcctcatctcccacacgggctcggccgtggagtgggtcacacccctgggcattcccatc
atccagccctaccaccgcatctccaagttcctgatcaagggtgggatccagagtatgacc
ttcaaccacagctccgacagcagccagcggcccaacacactgaagcagaagaatggcttc
ccacccaacttcatccactccctggattcctcccacatgatgttaacagccctgcactgc
tacaggaagggcctgaccttcgtctctgtccacgactgcttctggacccatgcagctgat
gtccctgtcatgaaccaggtgtgccgcgagcagttcgtcaggctgcacagccagcccatc
ctacgcgacctgtcccggttcctggtgaagcggttctgctctgccccaaggtctcagaat
ttgtccaagaacgcccagactcgcaagctgttcgagacactgctggctttgccggagaca
ggagacttcgacctggagcaggtgaagcagtccacgtacttcttcagctga

DBGET integrated database retrieval system