KEGG   Loxodonta africana (African savanna elephant): 100668912
Entry
100668912         CDS       T04351                                 

Gene name
NOS3
Definition
(RefSeq) LOW QUALITY PROTEIN: nitric oxide synthase, endothelial
  KO
K13242  nitric-oxide synthase, endothelial [EC:1.14.13.39]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav00220  Arginine biosynthesis
lav00330  Arginine and proline metabolism
lav01100  Metabolic pathways
lav04020  Calcium signaling pathway
lav04022  cGMP-PKG signaling pathway
lav04066  HIF-1 signaling pathway
lav04071  Sphingolipid signaling pathway
lav04151  PI3K-Akt signaling pathway
lav04370  VEGF signaling pathway
lav04371  Apelin signaling pathway
lav04611  Platelet activation
lav04915  Estrogen signaling pathway
lav04921  Oxytocin signaling pathway
lav04926  Relaxin signaling pathway
lav04931  Insulin resistance
lav04933  AGE-RAGE signaling pathway in diabetic complications
lav05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:lav00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    100668912 (NOS3)
   00330 Arginine and proline metabolism
    100668912 (NOS3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    100668912 (NOS3)
   04371 Apelin signaling pathway
    100668912 (NOS3)
   04066 HIF-1 signaling pathway
    100668912 (NOS3)
   04020 Calcium signaling pathway
    100668912 (NOS3)
   04071 Sphingolipid signaling pathway
    100668912 (NOS3)
   04022 cGMP-PKG signaling pathway
    100668912 (NOS3)
   04151 PI3K-Akt signaling pathway
    100668912 (NOS3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100668912 (NOS3)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    100668912 (NOS3)
   04921 Oxytocin signaling pathway
    100668912 (NOS3)
   04926 Relaxin signaling pathway
    100668912 (NOS3)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100668912 (NOS3)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    100668912 (NOS3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100668912 (NOS3)
Enzymes [BR:lav01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.39  nitric-oxide synthase (NADPH)
     100668912 (NOS3)
SSDB
Motif
Pfam: NO_synthase FAD_binding_1 Flavodoxin_1 NAD_binding_1
Other DBs
NCBI-GeneID: 100668912
NCBI-ProteinID: XP_023403844
LinkDB
Position
Unknown
AA seq 1219 aa
MGNLKSVGQEPRPPCGLGLGLGLGLCGKQGPASPASEPSWAPAPVPLPAPDHSPPLARPP
EGPKFPRVKNWEVGSITYDTLSAQAQQDGPCTPRHCLGSLVYPRKLQSRPSPHPAPPERL
LSQARDFIHQYYSSIKRSGSQAHEQRLQEVEDEVAATGTYQLRESELVFGAKQAWRNAPR
CVGRIQWGKLQVFDARDCSSAQEMFTYICNHIKYGTNRGNLRSAITVFPQRAPGRSDFRI
WNSQLVRYAGYRQQDGSVLGDPANVEITELCIQHGWTPGNGRFDVLPLLLQAPDEPPEVF
PLPPELVLEVPLEHPTLEWFAALGLRWYALPAVSNMLLEIGGLEFTAAPFSGWYMSTEIG
TRNLCDPHRYNILEDVAVCMDLDTRTTSSLWKDKAAVEINLAVLHSFQLAKVTIVDHHAA
TASFMKHLENEQKARGGCPADWAWIVPPISGSLTPVFHQEMVNYFLSPAFHYQPDPWKGS
AAKGTGITRKKTFKEVANAVKISASLMGTVMAKRVKATILYGSETGRAQSYAQQLGRLFR
KAFDPRVLCMDEYDVVSLEHETLVVVVTSTFGNGDPPENGESFAAALMEMTSPYNSSPRP
EQHKSYKMRFNSVSCSDPLVASWRRKRKESSNTDSAGALGTLRFCVFGLGSRAYPHFCAF
ARAVDTRLEELGGERLLQLGQGDELCGQEEAFRSWAQAAFQASCETFCVGEDAKAAARDI
FSPKWSWKRQRYRLSAQAKDLQLLPGLIHVHRRKMFQATVLSVENLQSSKSTRATILVRL
DTAEQQGLQYQPGDHVGVCPPNRPGLVEALLSRVEDPPPPSEPIAVEQLEKGSPGGPPPS
WVRDPRLPPCTLRQALTYFLDITSPPSPRLLRLLSTLAEEPSEQQELETLSQDPRRYEEW
KWFRCPTLLEVLEQFPSVALPAPLLLTQLPLLQPRDYSVSSAPSAHPGEIHLTVAVLAYR
TQDGLGPTCTMGGLFHVAEANFKGWETPLPLLSIRRGKRGQLPGAEVSPTRAPSFRLPPD
PSLPCILVGPGTGIAPFRGFWQERLNDIESKGLQPAPMTLVFGCRCSQLDHLYREEVQDA
QQRGVFGRVLTAFSREPDSPKTYVQDLLRTELAAEVHRVLCLERGHMFVCGDVTMATSVL
QTVQRILATEGNMELDEAGDVIGVLRDQQRYHEDIFGLTLRTQEVTSRIRTQSFSLQERQ
LRGAVPWAFDPPGPDTPGP
NT seq 3660 nt   +upstreamnt  +downstreamnt
atgggcaacttgaagagtgtgggccaggagcctaggcctccctgcgggctggggctgggg
ctgggccttgggctgtgcggcaagcagggcccagcctccccagcctctgagcccagctgg
gcaccagcaccagtgcccctacctgcgcctgaccacagccccccactagcccggcctcca
gagggacccaagttccctcgtgtgaagaactgggaagtggggagcatcacctatgatacc
ctgagtgcccaggcacagcaggatggaccctgcaccccaagacactgcctgggctccctt
gtatatccgcggaaactgcagagccggccctccccgcaccctgcaccccctgagaggctt
ctgagtcaggcccgggacttcatccaccagtactacagctccatcaagaggagtggctcc
caggcccacgagcagcgtcttcaggaggtagaagacgaggtggcagccacaggcacctac
cagcttcgggagagcgagctggtgttcggggccaagcaggcctggcgcaatgccccccga
tgcgtgggccgcatccagtgggggaagctgcaggtatttgatgcgcgggactgtagctct
gcgcaggagatgttcacctacatctgcaaccacatcaagtatggcaccaaccggggtaac
cttcgctctgccatcaccgtgttcccccaacgtgcccctggccgcagtgatttccgaatc
tggaacagccagctggtgcgctatgcaggctacagacagcaggatggctctgtgctgggg
gaccctgccaacgtggagatcaccgagctctgcatccagcatggctggaccccaggaaac
ggccgatttgacgtgctgcccctgctgctccaggccccagatgagcccccagaggtcttc
cctttgccccctgaactggtccttgaggtgcccctggagcaccccacgttggagtggttc
gcagcactgggcctgcggtggtatgccctcccagcagtgtccaacatgctgctggaaatc
gggggtctggagttcactgcagctcctttcagcggctggtacatgagcactgagattggc
actcggaacctgtgtgatccccaccgctacaacattctagaggatgtggctgtctgcatg
gacctggacacacggaccacctcgtccctgtggaaagataaggcagctgtggaaattaac
ttggctgtgctgcacagtttccagctagccaaagtgaccattgtggaccaccacgccgcc
acagcctccttcatgaagcacctggaaaatgagcagaaggcgaggggagggtgccctgct
gactgggcatggatcgtaccccccatctcgggcagcctcacacctgtcttccatcaggag
atggtcaactatttcctgtcccctgccttccactatcagccagatccctggaagggaagt
gcagccaagggtacaggcatcaccaggaagaagacctttaaggaagtggctaatgcagtg
aagatctctgcctcgctcatgggcactgtgatggctaagcgagtgaaggcgacaatcctg
tatggctctgagactggccgggcccagagctacgcacagcagcttgggaggctcttccgg
aaggctttcgatccccgggtcctgtgcatggatgagtatgacgtggtgtccctcgagcac
gagacactggtggtggtggtgaccagcacatttgggaacggtgatccacctgagaatggc
gagagctttgcagccgccctgatggaaatgaccagcccctacaacagctcccctcggcca
gaacagcacaagagctacaaaatgcgcttcaacagtgtctcctgctcagaccccctggtc
gcctcctggcggcggaagaggaaggagtccagtaacacggacagtgcgggggcgctgggc
accctcaggttctgtgtgttcgggctgggctcccgggcatatccccacttctgcgctttc
gcgcgcgcagtggacacgcggttggaagagctgggtggagagcggctgctgcagctgggc
cagggggatgagttgtgcggccaggaggaagccttccgtagctgggcccaggccgccttt
caggcctcctgtgagactttctgtgtgggggaagatgccaaggctgctgcccgggacata
ttcagtcccaaatggagctggaagcgccagagataccggctgagtgcccaggccaaggac
ctccagctgctgccaggcctgatccacgtacacaggcggaaaatgttccaagctacagtc
ctctcagtggaaaatctgcaaagcagcaagtctacccgggccaccatcctggtgcgccta
gacactgcagagcagcaggggctgcagtaccagcctggggaccatgtcggtgtctgccca
cccaaccggcctggcctggtggaggcgctgctgagccgtgtggaggacccaccgccgccc
tctgagcccattgcagtggagcagctagagaagggcagtcctggtggcccaccccccagc
tgggtacgggaccccagactgcccccgtgcacactgcgccaggctctgacctacttcctg
gacatcacatccccacccagccctcgactccttcgactgctcagcactctcgctgaagag
cccagcgaacagcaggagctggagaccctcagccaggaccccaggcgctatgaggagtgg
aagtggttccgctgccccacgctactggaagtgctggagcagtttccgtcagtggcattg
cctgctcccctgctcctcacccagctgcctctgctccagccacgggactactcagtcagc
tcagcacccagtgcccacccaggagagatccacctcacagtagctgtcctggcataccgg
acccaggatggcctgggccccacctgcactatgggaggcctgttccacgtggctgaagcc
aacttcaaaggctgggagactccgttgcccctgctttccatcagaaggggtaaacggggg
caactgcctggggcagaagtctctccaaccagggctccctccttccgactgccgcctgat
cccagcttgccctgcatccttgtgggacctggcacaggcattgcccccttccggggattc
tggcaggagagactgaacgacattgaaagcaaagggttgcagcccgcccccatgaccttg
gtgtttggctgccgatgctcccagcttgaccacctctaccgtgaggaggtgcaagacgcc
cagcagcgcggggtgtttggccgtgttctcaccgccttctcccgggaacccgacagcccc
aagacttacgtgcaggacctcctccggactgagctggctgccgaggtgcaccgcgtgctg
tgcctcgagcggggccacatgttcgtctgcggcgatgtcaccatggcgaccagcgtcctg
cagaccgtgcagcgcatcctggcgactgagggcaacatggagctggacgaggccggcgat
gtcatcggcgtgctgcgggatcagcaacgctatcacgaagacattttcggactcaccctg
cgcacccaggaggtgacaagccgcatacgcacccagagcttttccttgcaagagcggcag
ctccggggtgcagtgccctgggcattcgaccctcctggcccagacacccccggcccctga

DBGET integrated database retrieval system