KEGG   Loxodonta africana (African savanna elephant): 100668982
Entry
100668982         CDS       T04351                                 

Gene name
GLS
Definition
(RefSeq) glutaminase kidney isoform, mitochondrial isoform X4
  KO
K01425  glutaminase [EC:3.5.1.2]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav00220  Arginine biosynthesis
lav00250  Alanine, aspartate and glutamate metabolism
lav00471  D-Glutamine and D-glutamate metabolism
lav01100  Metabolic pathways
lav04724  Glutamatergic synapse
lav04727  GABAergic synapse
lav04964  Proximal tubule bicarbonate reclamation
lav05206  MicroRNAs in cancer
lav05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    100668982 (GLS)
   00220 Arginine biosynthesis
    100668982 (GLS)
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    100668982 (GLS)
 09150 Organismal Systems
  09155 Excretory system
   04964 Proximal tubule bicarbonate reclamation
    100668982 (GLS)
  09156 Nervous system
   04724 Glutamatergic synapse
    100668982 (GLS)
   04727 GABAergic synapse
    100668982 (GLS)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    100668982 (GLS)
   05230 Central carbon metabolism in cancer
    100668982 (GLS)
Enzymes [BR:lav01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     100668982 (GLS)
SSDB
Motif
Pfam: Glutaminase EF-hand_14
Other DBs
NCBI-GeneID: 100668982
NCBI-ProteinID: XP_010600977
LinkDB
Position
Unknown
AA seq 396 aa
MDMLRLTLQTTSDGVMLDKDLFKKCVQSNIVLLTQAFRRKFVIPDFMSFTSHIDELFESA
KKQSGGKVADYIPQLAKFSPDLWGVSVCTVDGQRHSIGDTKVPFCLQSCVKPLKYAIAVN
DLGTEYVHRYVGKEPSGLRFNKLFLNEDDKPHNPMVNAGAIVVTSLIKQGVNNAEKFDYV
MQFLNKMAGNEYVGFSNATFQSERESGDRNFAIGYYLKEKKCFPEGTDMVGILDFYFQLC
SIEVTCESASVMAATLANGGFCPITGERVLSPEAVRNTLSLMHSCGMYDFSGQFAFHVGL
PAKSGVAGGILLVVPNVMGMMCWSPPLDKMGNSVKGIHFCHDLVSLCNFHNYDNLRHFAK
KLDPRREGGDQRHPAIYAVDNLPEMFYLKRNIGYCY
NT seq 1191 nt   +upstreamnt  +downstreamnt
atggatatgttaagattaactcttcaaacaacatcagatggtgtcatgctagacaaagat
ctttttaaaaaatgtgttcaaagcaacattgttttattgacacaagcctttagaagaaag
tttgtcattcctgactttatgtcttttacctcacacatcgatgagttatttgaaagtgcc
aaaaagcagtccggaggaaaggttgcagattatattcctcaactggccaagttcagtcct
gatttgtggggtgtatcagtttgtacagtagatggacagaggcattcaattggagacacc
aaagttcccttttgtcttcagtcctgtgtaaaacctttgaagtacgccattgctgttaat
gaccttggaacagaatatgtgcatcgatatgttggaaaagagccgagtggattaagattc
aacaaactatttttaaatgaagatgacaagccacacaatcctatggtaaatgccggagca
attgttgtgacttccttaataaagcaaggagtaaataatgctgagaaatttgactatgtg
atgcagtttttgaataagatggctggtaatgaatatgttggattcagtaatgccacgttt
cagtctgaaagagaaagtggagatcggaattttgcaataggatattacttaaaagaaaaa
aagtgttttccagaaggcacagacatggttggtatattagacttctatttccagctatgc
tccattgaagtgacttgtgaatcagccagtgtgatggctgcaacactggctaatggtggc
ttttgcccaattactggtgaaagagtattgagccctgaagctgttcgaaatacactgagt
ttgatgcattcctgtggcatgtatgatttctcagggcagtttgctttccatgttggtctt
cctgcaaaatctggagttgctgggggcattcttttagttgtccccaatgtcatgggcatg
atgtgctggtctcctcctctggacaagatgggcaacagtgttaagggaattcatttttgt
catgaccttgtttctctgtgcaatttccataattatgataatctgagacactttgcaaaa
aaacttgatcctcgaagagaaggtggtgatcaaaggcaccctgcaatatatgctgtagac
aacttacctgaaatgttttacctgaaacgaaacattggctattgttactga

KEGG   Loxodonta africana (African savanna elephant): 100673149
Entry
100673149         CDS       T04351                                 

Gene name
GLS2
Definition
(RefSeq) glutaminase liver isoform, mitochondrial
  KO
K01425  glutaminase [EC:3.5.1.2]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav00220  Arginine biosynthesis
lav00250  Alanine, aspartate and glutamate metabolism
lav00471  D-Glutamine and D-glutamate metabolism
lav01100  Metabolic pathways
lav04724  Glutamatergic synapse
lav04727  GABAergic synapse
lav04964  Proximal tubule bicarbonate reclamation
lav05206  MicroRNAs in cancer
lav05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    100673149 (GLS2)
   00220 Arginine biosynthesis
    100673149 (GLS2)
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    100673149 (GLS2)
 09150 Organismal Systems
  09155 Excretory system
   04964 Proximal tubule bicarbonate reclamation
    100673149 (GLS2)
  09156 Nervous system
   04724 Glutamatergic synapse
    100673149 (GLS2)
   04727 GABAergic synapse
    100673149 (GLS2)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    100673149 (GLS2)
   05230 Central carbon metabolism in cancer
    100673149 (GLS2)
Enzymes [BR:lav01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     100673149 (GLS2)
SSDB
Motif
Pfam: Glutaminase Ank_4 Ank_2 Ank_5 Ank Ank_3
Other DBs
NCBI-GeneID: 100673149
NCBI-ProteinID: XP_023413398
LinkDB
Position
Unknown
AA seq 315 aa
MFFPLLPIPTPQISSTKSGACFRFQSEKETGDRNHAIGYYLKEKKCFPKGVDMMAALDLY
FQLCSVEVTCESGSVMAATLANGGICPITGESVLSAEAVRNTLSLMHSCGMYDFSGQFAF
HVGLPAKSAVSGAILLVVPNVMGMMCLSPPLDKLGNSHRGISFCQKLVSVFNFHNYDNLR
HCTRKLDPRREGREVRNKTVVNLLFAAYSGDVSALRRFALSAMDMEQKDYDSRTALHIAA
AEGHTEVVKFLTEACKVNPFVKDRWGNIPLDDAVQFNHLEVVKLLQDYQDSYIPSDTQAE
AVAEALSKENLESMV
NT seq 948 nt   +upstreamnt  +downstreamnt
atgttttttccccttctccccatacccacccctcaaatttcaagtactaaatcaggtgct
tgcttcagattccagtcagagaaggaaacaggggatcggaatcatgccatcggctattat
ctcaaggaaaagaagtgctttcctaagggggtggacatgatggctgcccttgatctctac
ttccagctgtgttctgtggaggtcacctgtgaatctggcagtgtcatggcagccaccctt
gccaacggcgggatctgccccatcacaggggagagtgtgttgagcgctgaagcagtgcgc
aacaccctcagcctcatgcattcctgcggcatgtatgatttctctggccagtttgccttc
catgtgggcctgccagctaagtcagctgtgtcaggagccatcctgctggtggtacccaat
gtcatgggaatgatgtgcctgtcaccaccactggacaagctggggaacagccacagaggc
atcagcttctgccagaagttggtgtctgttttcaatttccacaactatgacaacctgaga
cactgcactcggaagttagacccacggcgtgaagggagagaagttcggaacaagactgtg
gtgaacctgttatttgctgcctatagtggagatgtctcagctcttcgaaggtttgccttg
tcagccatggacatggaacagaaagactacgactcccgcacagccctgcatattgctgca
gctgaaggacacacagaagttgttaagttcctgactgaggcctgcaaagtgaatcctttt
gttaaggacaggtggggcaatattcccctggatgatgctgtgcaattcaaccacctggag
gtggtcaagctgcttcaagattaccaagactcctatataccatctgatactcaggctgag
gcagtggctgaggccctgtccaaagagaacttagagagcatggtgtga

DBGET integrated database retrieval system