KEGG   Loxodonta africana (African savanna elephant): 100669040
Entry
100669040         CDS       T04351                                 

Gene name
MAP2K5
Definition
(RefSeq) LOW QUALITY PROTEIN: dual specificity mitogen-activated protein kinase kinase 5
  KO
K04463  mitogen-activated protein kinase kinase 5 [EC:2.7.12.2]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04010  MAPK signaling pathway
lav04540  Gap junction
lav04722  Neurotrophin signaling pathway
lav04921  Oxytocin signaling pathway
lav05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100669040 (MAP2K5)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100669040 (MAP2K5)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    100669040 (MAP2K5)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100669040 (MAP2K5)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100669040 (MAP2K5)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lav01001]
    100669040 (MAP2K5)
Enzymes [BR:lav01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     100669040 (MAP2K5)
Protein kinases [BR:lav01001]
 Serine/threonine kinases: STE group
  STE7 family
   100669040 (MAP2K5)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PB1 Pkinase_fungal Kinase-like Seadorna_VP7
Other DBs
NCBI-GeneID: 100669040
NCBI-ProteinID: XP_003418474
LinkDB
Position
Unknown
AA seq 448 aa
MLWLGFGPFHAMENQVLVIRIKIPNSGAVDWTVHSGPQLLFRDVLDVIGQVLPEATTTAF
EYEDEDGDRITVRSDEEMKAMLSYYYSTVMEQQVNGQLTEPLQIFPRACKPPGERNIHGL
KVNTRAGPXQHSSPAVSDSLPSNSLKKSSAELKKILANGQMNEQDIRYRDTLGHGNGGTV
YKAYHVPSGKILAVKVILLDITLELQKQIMSELEILYKCDSSYIIGFYGAFFVENRISIC
TEFMDGGSLDVYRKIPEHVLGRIAVAVVKGLTYLWSLKILHRDVKPSNMLVNTRGQVKLC
DFGVSTQLVNSIAKTYVGTNAYMAPERISGEQYGIHSDVWSLGISFMELALGRFPYPQIQ
KNQGSLMPLQLLQCIVDEDSPILPVGEFSEPFVHFITQCMRKQPKERPAPEELMGHPFIM
QFNDGNAAVVSMWVCRELEERRSQQGPL
NT seq 1347 nt   +upstreamnt  +downstreamnt
atgctgtggctgggctttggccccttccatgccatggagaaccaggtgctggtcattcgc
atcaagattccaaacagtggcgcggtggactggacagtgcactccgggccgcagttactc
ttcagggatgtgctggatgtgataggccaggttctgcctgaagcaacaaccaccgcattt
gaatatgaagatgaagatggtgatcgaattacagtgagaagtgatgaagaaatgaaggcc
atgctgtcgtattattattccacagtaatggaacagcaagtaaatggacagttaacagag
cctctgcagatatttccaagagcctgcaagcctcctggggaacggaacatacatggcctg
aaggtgaatacgcgggccggacctnctcaacacagcagcccagcagtctcagattcactg
ccaagcaatagcttgaagaagtcttccgctgaactgaaaaaaatactagccaatggccag
atgaatgaacaagacatacgatatcgagacactcttggccatggcaacggaggcacagtc
tacaaagcatatcatgtcccaagtgggaaaatattagctgtaaaggtcatactactagat
attacactggaacttcagaagcaaattatgtctgaattggaaattctttataagtgtgat
tcatcgtatatcatagggttttatggtgcattttttgtagaaaacaggatttcaatatgt
acagaattcatggatgggggatctttggatgtatatagaaaaatcccagagcacgtcctt
ggaagaattgcagtagcagttgttaaaggccttacctatttgtggagtttaaagatttta
catagagatgtgaagccctccaatatgctagtgaacaccagaggacaggtcaagctgtgt
gattttggagttagcactcagctggtgaattctatagccaagacgtatgttggaacaaat
gcttacatggcgcccgaaagaatttcaggggagcagtatggaatccattctgatgtctgg
agcttaggaatctctttcatggagcttgctcttgggaggtttccatatcctcagattcag
aaaaaccagggatctttaatgcctctccagcttctgcagtgcattgttgatgaggattcg
cccatccttccggttggcgagttctctgagccatttgtacatttcatcactcagtgcatg
cgaaaacagccaaaagaaaggccagcacctgaggaactgatgggtcacccgttcatcatg
cagttcaacgatgggaacgctgctgtggtgtccatgtgggtatgcagggaactggaggag
aggcggagccagcaggggcccctgtga

DBGET integrated database retrieval system