KEGG   Loxodonta africana (African savanna elephant): 100669095
Entry
100669095         CDS       T04351                                 

Gene name
KL
Definition
(RefSeq) klotho
  KO
K14756  klotho [EC:3.2.1.31]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav00040  Pentose and glucuronate interconversions
lav00053  Ascorbate and aldarate metabolism
lav01100  Metabolic pathways
lav04211  Longevity regulating pathway
lav04928  Parathyroid hormone synthesis, secretion and action
lav04961  Endocrine and other factor-regulated calcium reabsorption
Brite
KEGG Orthology (KO) [BR:lav00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    100669095 (KL)
   00053 Ascorbate and aldarate metabolism
    100669095 (KL)
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    100669095 (KL)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    100669095 (KL)
  09149 Aging
   04211 Longevity regulating pathway
    100669095 (KL)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:lav02000]
    100669095 (KL)
   04147 Exosome [BR:lav04147]
    100669095 (KL)
Enzymes [BR:lav01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.31  beta-glucuronidase
     100669095 (KL)
Transporters [BR:lav02000]
 Other transporters
  Accessory factors involved in transport [TC:8]
   100669095 (KL)
Exosome [BR:lav04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100669095 (KL)
SSDB
Motif
Pfam: Glyco_hydro_1
Other DBs
NCBI-GeneID: 100669095
NCBI-ProteinID: XP_003409681
LinkDB
Position
Unknown
AA seq 1043 aa
MGRCAQVRSGTLTSPSARRSRARSPGAPPPLVRVMIAHGGRGATIKGGPRSCQHPESAQN
ARPGVLCRAPCRAGHGQMISTPEAAGLLHDAFPDGFLWAVGSAAYQTEGGWQQHGKGASI
WDTFTHHPPGLPRDPPLAGRPTGAPSSSPPATGDVASDSYNNVFRDTEGLRELGVTHYRF
SISWARVLPNGSAGAPNREGLRYYRRLLERLRELGVQPVVTLYHWDLPQRLQDAYGGWAN
RALADLFRDYAELCFRHFGSQVKHWITIDNPYVVAWHGYATGRLAPGVRGSARLGYLVAH
NLLLAHAKVWHLYNTSFRPTQGGQVSIALSSHWISPRRMTDHGIKECQKSLDFVLGWFAK
PVFIDGDYPESMRSNLSSLLPEFTESERKFVKGTADFFALSFGPTLSFQLLDPHMKFRQL
ESPSLRQLLFWIDLEYNHPPIFIVENGWFVSGTTKRDDAKSMYYLKKFIMETLKAIRLDG
VNVIGYTAWSLMDGFEWHRGYSVRRGLFYVDFLSQDKKLWPKSSALFYQKLIEKNGFPPL
PENQPLEGTFPCDFAWGIVDNHVQVDTTLSQFTDPNVYLWDVHHSKRLIKVDGVVTKKRK
SYCVDFAAIRPQIALLQETHVTHFHFSLDWALVLPLGNQSQINGTVLRYYRCLVGELVRA
NVTPVVALWQPVAPHQGLPGPLAQRGAWENPHTALAFVEYARLCFKELGHSVKFWITMNQ
PPTRNMTYSAGHNLLRAHALAWRVYDENFRRAQKGQVSIALQADWIEPACPSSQKDKEVA
DRVLEFDIGWLAEPIFGSGDYPHVMRDWLSQRNNFLLPYFTEDDKKLIQGSFDFLALSHY
TTILVDWEKEDPGKYNDYLEVQEMTDITWLNSPSQVAVVPWGLRRVLNWLKSKYGDLPMY
VIANGIDGDPQETEDKLRVHYIQNYVNEALKAYILDGINLCGYFAYSLSDRTAPKFGLFR
YAANQFEPKPSMKHYRKIIDNNGFLGPGSLGRFCPEEFTVCTECSFFHSRKTLLAFLACL
FFAFIISLSLIFYYSKKGRRSYK
NT seq 3132 nt   +upstreamnt  +downstreamnt
atgggccggtgcgcccaagtccgaagcggcaccctcacctcgcctagtgcgcgccgctcc
cgggcccgctcgccgggtgcgcccccgcccctggtccgggtaatgattgcccacgggggc
cggggcgccaccataaagggcggcccgcggagctgccaacatccggaatccgcgcagaat
gcccgacctggcgttctatgccgcgcgccctgtcgcgccggccacgggcagatgatctcc
acccccgaggcggccggcctgctgcacgacgccttccccgacggcttcctctgggccgtg
ggcagcgccgcctaccagaccgagggcgggtggcagcagcacggcaaaggcgcgtccatc
tgggataccttcacccatcaccccccagggctcccgcgcgaccctccgctcgctggccgg
ccgacgggagccccgtcgtcctccccgcccgccaccggggacgtggccagcgacagctac
aacaatgttttccgcgacacggaggggctgcgcgaactcggggtcacccactaccgcttc
tccatctcctgggcccgggtcctccccaatggcagcgcgggcgcccccaaccgagagggg
ctgcggtactaccggcgcctgctggagcggctgcgggagctgggcgtgcagcccgtggtc
actctgtaccactgggacctgccccagcgcctgcaggacgcctatggcggctgggccaac
cgcgccctggcggacctcttcagggactacgccgaactctgcttccgccacttcggcagt
caggtcaagcactggatcaccatcgacaacccctacgtggtggcttggcacggctacgcc
accggacgcctggctcccggcgtccggggcagcgcgcggcttgggtacctggtggcgcac
aacctcctcctggctcatgccaaagtctggcatctgtacaatacttctttccgtccaact
caaggaggccaggtgtccatcgccctaagctctcactggatcagtcctcgaagaatgact
gatcatggcatcaaagaatgccagaaatctctggactttgtactcggctggtttgcgaaa
cccgtatttattgacggtgactaccctgagagtatgaggagtaacctttcatctcttctg
cctgagtttaccgaatctgagagaaagttcgtgaaggggacagctgacttctttgctctt
tcctttggacctaccttgagtttccagctgttggaccctcacatgaagttccggcagtta
gaatcccccagcctgaggcagctgcttttctggatagaccttgaatataaccaccctcca
atatttattgtggaaaatggctggtttgtctcggggaccaccaagagagatgatgccaaa
tctatgtattacctcaaaaagttcataatggaaaccttgaaagccatcagactggatggg
gtcaatgtcatcgggtacactgcgtggtcgctcatggatggcttcgagtggcacagaggg
tacagcgtcagacgtgggctcttctatgttgattttctaagccaggataagaagctgtgg
cccaagtcttcagccttgttctaccaaaaactgatagagaaaaatggcttcccgccttta
cctgaaaaccaacccctagaagggacatttccctgtgactttgcatgggggattgttgat
aaccacgtgcaagtagacaccaccctgtctcagtttacggacccgaatgtttacctgtgg
gatgtccaccacagcaagaggctcattaaagtggacggggtggtgaccaagaagaggaaa
tcctactgtgttgactttgccgctatccggccccagatcgccttgctccaggagacgcac
gtcacccatttccacttctccctggattgggccctggtcctccccttggggaaccagtcc
cagatcaacggcacggtcctgcgttactaccgctgcctggtcggtgagctggtccgtgcc
aacgtcaccccagtggtggccctgtggcagccagtagccccacaccaaggactgccaggc
cccctggcccagcgtggcgcctgggagaacccccacacggccctggcatttgtggagtat
gccagactgtgctttaaggagctcggccactctgtcaagttctggatcaccatgaaccag
ccacctacaaggaacatgacctacagcgccggacacaacctcctgagagcccacgcgctg
gcgtggcgtgtgtatgacgagaacttcaggcgtgctcagaaaggccaggtatccatagct
ctgcaggcggactggatagagccggcctgcccttcctcccagaaggacaaagaagtggcc
gacagggttctggagttcgacattggctggctcgccgagcccattttcggctctggagat
tacccacatgtcatgagggattggctgagccagagaaacaattttcttctcccctatttc
acggaagatgacaagaagttgatccagggctcctttgactttctggcattaagccattac
actaccatccttgtcgactgggagaaggaggacccagggaagtacaatgattacctggaa
gttcaagagatgacggacatcacctggcttaactctcccagtcaggtggccgtggtgccc
tggggcttacgcagagtgctgaactggctgaaatcgaagtacggagacctccccatgtac
gtgatagccaatggaatcgatggcgatccgcaggagacagaggacaagctgagggtgcat
tacatacaaaactatgtaaacgaagctctgaaagcttacatattggatggtatcaatctt
tgcggatactttgcttattcactgagtgaccgcactgctcccaagtttggcctctttcgt
tatgccgcgaatcagtttgaacccaaaccgtccatgaaacactacaggaaaattattgac
aacaacggcttcctgggccctggaagtctgggaaggttctgtccggaagaatttaccgtg
tgcacagagtgcagcttctttcattccagaaagactttactggctttcctagcttgtcta
ttctttgcttttattatttccctttccctaattttttactactctaagaaaggtcgaaga
agttacaaatag

DBGET integrated database retrieval system