KEGG   Loxodonta africana (African savanna elephant): 100669102
Entry
100669102         CDS       T04351                                 

Gene name
POMC
Definition
(RefSeq) LOW QUALITY PROTEIN: pro-opiomelanocortin
  KO
K05228  proopiomelanocortin
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04024  cAMP signaling pathway
lav04080  Neuroactive ligand-receptor interaction
lav04915  Estrogen signaling pathway
lav04916  Melanogenesis
lav04920  Adipocytokine signaling pathway
lav04925  Aldosterone synthesis and secretion
lav04927  Cortisol synthesis and secretion
lav04934  Cushing syndrome
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    100669102 (POMC)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100669102 (POMC)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    100669102 (POMC)
   04915 Estrogen signaling pathway
    100669102 (POMC)
   04916 Melanogenesis
    100669102 (POMC)
   04925 Aldosterone synthesis and secretion
    100669102 (POMC)
   04927 Cortisol synthesis and secretion
    100669102 (POMC)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100669102 (POMC)
SSDB
Motif
Pfam: ACTH_domain Op_neuropeptide NPP
Other DBs
NCBI-GeneID: 100669102
NCBI-ProteinID: XP_010590340
LinkDB
Position
Unknown
AA seq 186 aa
MPRSCCSCSGVLLLALLLQVSMEVRGWCLESSQCQDLTTESNLLSGPREGKRSYXMEHFR
WGKPVGKKRRPVKVYPNGAEGESAEAFPLEFKRELARERPEPARGPEGPDEGAATQADLD
NGLVAEVEATSAEKKDEGPYKMEHFRWGSPAKDKRYGGFMTSEKSQTPLVTLFKNAIIKN
AYKKGH
NT seq 561 nt   +upstreamnt  +downstreamnt
atgcctcgatcctgctgcagctgctcaggggtcctgctgctggctttgctgcttcaggtc
tccatggaagtacgcggctggtgcctggagagcagccagtgtcaggacctcaccacggaa
agcaacctgctgtcgggcccgcgcgagggcaagcgctcctacntcatggagcactttcgc
tggggcaagccggtgggcaagaagaggcgcccggtgaaggtgtaccccaacggcgccgag
ggcgagtcagccgaggccttccccctcgagttcaagcgggagctggcccgggagcggccc
gagccggcgcgcggccccgagggcccggacgagggcgcggccacccaggccgacctggac
aatggcctcgtggcggaggtcgaggcgacgtcggccgagaagaaggacgaggggccctac
aagatggagcacttccgctggggcagccccgccaaggacaagcgctacggcggcttcatg
acctccgagaaaagccagacgcccctggtgacgctgttcaaaaacgccatcatcaagaac
gcctacaagaagggccactga

DBGET integrated database retrieval system