KEGG   Loxodonta africana (African savanna elephant): 100669109Help
Entry
100669109         CDS       T04351                                 

Gene name
LDLR
Definition
(RefSeq) low-density lipoprotein receptor isoform X2
  KO
K12473  low-density lipoprotein receptor
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04144  Endocytosis
lav04913  Ovarian steroidogenesis
lav04925  Aldosterone synthesis and secretion
lav04927  Cortisol synthesis and secretion
lav04934  Cushing syndrome
lav04976  Bile secretion
lav04979  Cholesterol metabolism
lav05145  Toxoplasmosis
lav05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:lav00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100669109 (LDLR)
 09150 Organismal Systems
  09152 Endocrine system
   04913 Ovarian steroidogenesis
    100669109 (LDLR)
   04925 Aldosterone synthesis and secretion
    100669109 (LDLR)
   04927 Cortisol synthesis and secretion
    100669109 (LDLR)
  09154 Digestive system
   04976 Bile secretion
    100669109 (LDLR)
   04979 Cholesterol metabolism
    100669109 (LDLR)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100669109 (LDLR)
  09172 Infectious disease: viral
   05160 Hepatitis C
    100669109 (LDLR)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100669109 (LDLR)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:lav04131]
    100669109 (LDLR)
Membrane trafficking [BR:lav04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Low-density lipoprotein receptor (LDLR) family proteins
    100669109 (LDLR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ldl_recept_a Ldl_recept_b FXa_inhibition cEGF EGF_CA SGL EGF
Motif
Other DBs
NCBI-GeneID: 100669109
NCBI-ProteinID: XP_010591642
LinkDB All DBs
Position
Unknown
AA seq 872 aa AA seqDB search
MGSAGWGLRCAIALLLAAAGAAGDKCGRKEFQCRDGKCISYKWVCDGSAECQDGSDESQE
TCKSVTCQSGDFSCGGRVNRCIPQFWRCDGQVDCENGSDEQYCAPKTCSQDQFRCHDGKC
ISQVFVCDSDQDCLDGSDEDACPVTMTTCGPANFQCNTSTCIPELWACDGDPDCEDGSDE
WLQHCEGRNTSAPQRDNGPCSSFEFHCRSGECIHTSWRCDAAPDCKDKSDEEDCAVATCR
PDQFQCGDGTCIHGSRQCDKEYDCKDLSDEVGCINVTLCEGPNKFKCHSGECITLDKVCN
SVRDCRDWSDEPLKECGTNECLDNKGGCSHVCNDLKIGYECLCPEGFRLVDQRRCEDIDE
CQDPDSCSQICVNLEGGYKCECHKGFQIDPHTKACKAVGTIAYLFFTNRHEVRKMTLDRS
EYTSLITNLKNVVALDTEVASNRIYWSDLSQRKIYSTQIDRAHSFSSYDTVISKDLHAPD
GLAVDWVHSHIYWTDSVLGTVSVADTRGVKRKTLFKEKDSKPRAIVVDPAHGFMYWTDWG
TPAKIKKGGLNGVDIYSLVTEDIQWPNGITLDLSSGRLYWVDSKLHSISSIDVNGSNRKT
VLEDKNRLAHPFSLAIFEDKVFWTDIINEAIFSANRLTGSDINLVAGNLLSPEDMVLFHN
LMQPRGVNWCEKTSLHNGGCQYLCLPAPQINPHSPKFTCACPDGMLLAKDMRSCITEAEP
AATTEGSTTKGSSTAGSTFRQMVSSVATEPKQTASPPAPSTSRQPTASTEFTTAEMATVS
HQALGDVAGRGTEEKPRRVGALSIILPIVLLVLLCSGAFLLWKNWRLKSINSINFDNPVY
QKTTEDEVHICRSQDGYTYPSRQMVSLEDDMA
NT seq 2619 nt NT seq  +upstreamnt  +downstreamnt
atggggtcggcaggctgggggctgcgctgcgccatcgccctgctcctcgccgcggcggga
gctgcaggagacaagtgtgggaggaaggagttccagtgccgagatgggaaatgcatctct
tacaagtgggtctgtgacgggagtgccgagtgccaggacggctctgacgagtcccaggag
acatgcaagtctgttacctgccaatctggggacttcagctgtgggggccgggtcaaccgc
tgcattcctcagttctggagatgtgatggccaagtggactgtgagaatggctcagatgag
caatactgcgcccccaagacatgctcgcaggaccagttccgttgccacgatggcaagtgc
atctcgcaggtgtttgtctgtgactcagaccaggattgcttagacggctcagatgaggac
gcctgccctgtgaccatgaccacctgcggccctgccaactttcagtgcaacacctccacc
tgcatccctgagctgtgggcctgcgatggtgaccctgactgcgaggatggctcggacgag
tggctgcagcactgtgagggccgcaacacatctgccccacaaagggacaatggcccctgc
tcctccttcgagtttcactgccgcagcggcgagtgtatccacaccagctggcgctgtgat
gccgcccccgactgcaaggacaagtcagacgaggaggactgtgctgtggctacgtgccgg
cctgaccagttccagtgcggagatgggacctgtatccatggcagccggcagtgcgacaag
gagtacgactgcaaggacctgagcgacgaggtcggctgcatcaatgtgacgctgtgtgag
gggcccaacaaattcaagtgccacagtggcgaatgcatcacactggacaaagtgtgcaac
tcagtcagggactgccgggactggtcggacgagcccctcaaggagtgcggtaccaacgag
tgtctggacaacaaaggaggctgctcacatgtctgcaacgacctcaagattggctacgag
tgcctctgccctgagggcttccggctagtggaccagagaagatgcgaagatatcgacgag
tgtcaggaccccgacagctgcagccagatctgtgtgaacctcgaggggggctataagtgc
gagtgtcacaagggcttccagattgacccccacaccaaggcctgcaaagccgtcggcacc
atcgcttacctcttcttcaccaaccgccatgaagtgaggaagatgacactggaccggagc
gagtacaccagcctcatcaccaacctgaagaacgtggtcgccctcgacacggaggtggcc
agcaacagaatctactggtctgacctgtcccagaggaagatttacagcacccagattgac
agagcccacagcttctcctcctatgacactgtcatcagcaaggacctgcatgcccctgat
gggctggccgtggactgggtccatagccacatatactggaccgactctgtcctcggcact
gtctcagtggccgacaccaggggtgtgaagaggaaaacactattcaaggagaaagactca
aaaccccgggcaattgtggtggaccctgctcacggcttcatgtactggacggattggggg
acccctgcaaagatcaagaaagggggtctgaatggtgtggacatctactcgctggtgacg
gaagacatccagtggcccaatggcatcaccctggatctttccagtggccgcctctactgg
gtcgactccaaacttcactccatctccagcattgatgtcaatgggagcaaccggaagact
gttttggaggacaagaaccgtctggctcacccgttctccctggcgatctttgaggataaa
gtattttggacagatatcatcaatgaagccattttcagtgccaaccgcctcacaggctca
gacattaatttggtggctgggaatctgctgtccccggaggacatggtcctgttccacaac
ctcatgcagccgagaggggtgaactggtgtgagaagacttccctccacaatggtggctgc
cagtacctgtgcctcccagccccgcagatcaacccccattcacccaagttcacctgtgcc
tgccctgatggcatgctgctggccaaagacatgaggagctgcatcacagaggctgaaccc
gcagccaccaccgaggggtctaccaccaaggggtcctccacagctggatccacattcagg
cagatggtcagctctgtggccacggagccaaagcagacagccagcccgcctgctcccagc
acctccaggcagcccacggccagcactgagttcaccacagcagagatggctaccgtgtcc
caccaagccctgggcgacgttgctggcagaggaaccgaggagaagcccaggcgcgtgggg
gcactgtccatcatcctccccattgtgctgctcgtcctcctctgctccggggccttcctc
ctctggaagaactggcggctgaagagcatcaacagcatcaacttcgacaaccctgtctac
cagaagaccactgaggacgaggtccacatctgccgcagccaggatggctacacctacccc
tcgagacagatggtcagcctggaagacgacatggcatga

DBGET integrated database retrieval system