KEGG   Loxodonta africana (African savanna elephant): 100669213
Entry
100669213         CDS       T04351                                 

Gene name
GAB1
Definition
(RefSeq) GRB2-associated-binding protein 1 isoform X2
  KO
K09593  GRB2-associated-binding protein 1
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav01521  EGFR tyrosine kinase inhibitor resistance
lav04012  ErbB signaling pathway
lav04014  Ras signaling pathway
lav04072  Phospholipase D signaling pathway
lav04722  Neurotrophin signaling pathway
lav05100  Bacterial invasion of epithelial cells
lav05205  Proteoglycans in cancer
lav05211  Renal cell carcinoma
lav05225  Hepatocellular carcinoma
lav05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100669213 (GAB1)
   04014 Ras signaling pathway
    100669213 (GAB1)
   04072 Phospholipase D signaling pathway
    100669213 (GAB1)
 09150 Organismal Systems
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100669213 (GAB1)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    100669213 (GAB1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100669213 (GAB1)
   05226 Gastric cancer
    100669213 (GAB1)
   05211 Renal cell carcinoma
    100669213 (GAB1)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    100669213 (GAB1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100669213 (GAB1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:lav04990]
    100669213 (GAB1)
Domain-containing proteins not elsewhere classified [BR:lav04990]
 Pleckstrin homology (PH) domain-containing proteins
  Grb-2 associated binder (Gab) family proteins
   100669213 (GAB1)
SSDB
Motif
Pfam: PH PH_11 PH_9 PH_8 PH_3 PH_13
Other DBs
NCBI-GeneID: 100669213
NCBI-ProteinID: XP_003417550
UniProt: G3SQF6
LinkDB
Position
Unknown
AA seq 694 aa
MSGGEVVCSGWLRKSPPEKKLKRYAWKRRWFVLRSGRLTGDPDVLEYYKNDHAKKPIRII
DLNLCQQVDAGLTFNKKEFENSYIFDINTIDRIFYLVADSEEEMNKWVRCICDICGFNPT
EEDAVKPPGPSLQAPADLPLPVNTAPPSTHVDSSSATLPPPYQLINLPPHLETLGIQEDP
QDYLLLINCQSKKPEPMRTHADSAKSTSSETDCNDNVPSHKNPASSQSKHGVNGFFQQQM
MYDSPSSRAASVSVDSSLYNLPRSYSHDVLPKVSPSSTEADGELYVFNTPAGTSSVETQM
RHVSISYDIPSTPGNTYQIPRTFPEGTLGQTSKLETIPDIPPPRPPKPHPAHDRSPVETC
SITRTASDTDSSYCIPTAGMPPSRSNTISTVDLNKLRKDASSQDCYDIPRTFPSDRSSSL
EGFHNHFKIKNVLTVGSVSSEELNENYVPMNPNSPPRQHSTGFTEPIQEANYVPMTPGTF
DFSSFGMQVPPPAHMGFRSSPKTPPRRPVPVADCEPPPVDRNLKPDRKVKPAPLEIKPLT
EWEELQAPVRSPITRSFARDSSRFPLSPRPDSVHSTTSSSDSHDSEENYVPMNPNLSNED
PNLFGSNSLDGGSSPMVKPKGDKQVEYLDLDLDSGKSTPPRKQKSSGSGSSVADERVDYV
VVDQQKTLALKSTREAWTDGRQSTESETPTKSVK
NT seq 2085 nt   +upstreamnt  +downstreamnt
atgagcggtggcgaagtggtctgctcggggtggctccgcaagtccccgccggagaaaaag
ttgaagcgttatgcatggaagaggagatggtttgtgttgcgcagtggccgtttaactgga
gatccagatgtattggaatattacaaaaatgatcatgctaagaagcctatccgtatcatt
gatttaaatttatgtcagcaagtcgatgctggattgacatttaacaaaaaagagtttgaa
aacagctacatttttgatatcaacactattgaccggattttctacttggtagcagacagt
gaggaggagatgaataagtgggttcgttgtatttgtgacatctgtgggttcaaccctaca
gaggaagatgctgtgaagccacctggcccttccttacaagcaccagctgatttaccttta
cctgtaaatacagcaccaccgtccacacacgtggattcatcctctgctactctacctcct
ccatatcagctaattaaccttccaccacacctggaaactcttggcatccaggaggatcct
caagactacctcttgctaatcaactgtcaaagcaagaagcctgaacccatgagaacacat
gccgactctgcaaaatccacctcttcggaaacagactgcaacgataacgtcccttctcat
aaaaaccctgcttcttcccagagcaaacacggagtgaatggcttttttcagcagcaaatg
atgtatgactccccatcgtcacgtgctgcatctgtttctgtagactccagcctttataac
ctgcccaggagttactcccatgatgttttaccaaaggtgtctccatcaagtaccgaagca
gatggagaactctatgtttttaataccccagctgggacgtcgagtgtagagactcaaatg
cggcacgtatctatcagttacgacattccttcaacacctggtaacacttaccagattcca
cgaacatttccagaaggaaccttgggacagacgtccaagctagagactattccagatatt
cctccacctcggccaccgaaaccacatccagctcatgaccgatctcctgtggaaacgtgc
agtatcacacgcacggcctcagacactgacagtagttactgtatcccgacagcagggatg
cccccgtcacgtagcaataccatttccactgtggatttgaacaaattacgaaaagatgct
agctctcaagactgctatgatattccacgaacatttccaagtgatagatctagctcactt
gaaggcttccacaaccactttaaaatcaaaaatgtgttgacagtgggaagcgtatcaagt
gaagaactgaatgaaaattatgttcctatgaatcccaactctccaccacggcaacattcc
accggttttacggaaccaattcaggaagcaaattatgtgccaatgacaccagggacattt
gatttttcttcatttggaatgcaagttcctcctccggctcatatgggcttcaggtccagc
ccaaagacccctcccagaaggccagtgcctgtggcagactgtgaaccaccccccgtggat
agaaacctcaagccagacagaaaagtcaagccagcacctttggaaataaaacctttgaca
gaatgggaagaattacaagctccagttcgatctcccatcactaggagttttgctcgagac
tcctctaggtttcctctgtccccccgaccggattccgtgcatagcacaacttcaagcagt
gactctcacgacagcgaagagaattatgttcccatgaatccgaacctgtccaatgaagac
cctaatctttttggcagtaatagtcttgatggaggaagcagccctatggtaaagcccaaa
ggagacaaacaagtggaatacctagatttagatttagattctgggaaatccacaccacca
cgtaagcaaaagagcagcggctcaggcagcagtgtagcagatgagagggttgattatgtt
gtggttgaccaacagaagaccctggcactgaagagcacccgggaagcctggactgatggc
agacagtccacggaatctgaaacacccaccaagagcgtgaaatga

DBGET integrated database retrieval system