KEGG   Loxodonta africana (African savanna elephant): 100669221
Entry
100669221         CDS       T04351                                 

Gene name
DAPK2
Definition
(RefSeq) death-associated protein kinase 2 isoform X1
  KO
K08803  death-associated protein kinase [EC:2.7.11.1]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04140  Autophagy - animal
lav05200  Pathways in cancer
lav05219  Bladder cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100669221 (DAPK2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100669221 (DAPK2)
  09162 Cancer: specific types
   05219 Bladder cancer
    100669221 (DAPK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lav01001]
    100669221 (DAPK2)
Enzymes [BR:lav01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100669221 (DAPK2)
Protein kinases [BR:lav01001]
 Serine/threonine kinases: CAMK group
  DAPK family
   100669221 (DAPK2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo RIO1 Filament Rootletin FAP206 Lectin_N Glycos_trans_3N
Other DBs
NCBI-GeneID: 100669221
NCBI-ProteinID: XP_023414094
LinkDB
Position
Unknown
AA seq 471 aa
METFKQQKVEDFYDIGEELGSGQFAIVKKCREKSTGLEYAAKFIKKRQNQASRRGVQREE
IEREVNILRQVLHPNVITLHDVYENRTDVVLILELVSGGELFDFLAQKESLSEEEATSFI
KQILEGVNYLHAKKIAHFDLKPENIMLLDKDIPIPHIKLIDFGLAHEIEDGVEFKSIFGT
PEFVAPEIVNYEPLGLEADMWSIGVITYILLSGASPFLGDTKQETLANITAVSYDFDEEF
FSQTSELAKDFIRKLLVKETRKRLTIQEALTHPWIMLKGDVRAPEQRKTKRLREYTLKCH
SSMPPNNTYINFERFAHVVEDMALVEQGCRSLAGAHDTIQDDVEALVSIYNEKEAWYREE
SENTRHHLSQLRYEFRKVESLKKLLREDIRATGSSLGSVGRKLDRLQAQFEDLRQELSAD
LQWIQDLVGSFQLESGNTDGLGSVFHQDASESLTELLNRACSEEVLAGLKF
NT seq 1416 nt   +upstreamnt  +downstreamnt
atggagacgttcaagcagcagaaggtggaggacttttatgacatcggggaggagctgggg
agcggccagttcgccatcgtgaagaagtgccgagagaagagcacggggctggaatacgca
gccaagttcatcaagaagcggcagaaccaggccagccggcggggcgtgcagcgggaggag
atcgagcgggaggtgaacatcctgcggcaggtgctgcaccccaacgtcatcacgctgcac
gacgtctacgagaaccgtaccgacgtggtgctcatcctggagctagtgtccggaggagag
ctctttgacttcctggcccagaaggagtcactgagtgaggaggaggccaccagcttcatt
aagcagatcctagagggggtgaactaccttcatgccaagaagattgctcactttgatctc
aagccagaaaacattatgttgttagacaaggatattcccattccacacatcaagctgatt
gactttggcctggctcatgaaatagaagacggagttgagtttaagagcatttttgggacg
ccggaatttgttgctccagaaatcgtgaactatgagcccctggggctggaggctgacatg
tggagcatcggtgtcatcacctatatcctcctaagcggagcatcccctttcctgggagac
acgaagcaggaaacgctggcaaatatcacagcagtgagttatgactttgacgaggaattc
ttcagccaaactagtgagctggccaaggacttcattcggaagcttctggttaaagagacc
cggaaacgactcacgatccaagaggctctcacacacccctggatcatgttgaaaggagac
gtcagagcccctgaacagcggaagaccaagcgcctgagagagtacaccctcaagtgccac
tcaagcatgccccccaacaacacctacatcaacttcgagcgttttgcccacgtggtagag
gacatggctctggtggagcagggatgccgctccctggcgggggcccatgataccatccag
gacgacgtggaggccttggtctccatctacaatgagaaggaggcctggtaccgagaggaa
agcgagaacacccggcatcacctgtcccagctcaggtacgagtttcgcaaggtagagtcc
ctgaagaaactcctgcgcgaagacatccgggctacagggtccagccttggaagcgtgggc
aggaaattggaccgtctgcaggcgcagtttgaggatctaaggcaggagctctcagcagac
ctacagtggatccaggatctggtgggcagcttccagctggagagtgggaacacagatggc
ctgggctccgtgttccaccaggacgccagtgaatccctgacggagctgctcaacagagcg
tgcagtgaggaagtcctggccggcttgaagttctga

KEGG   Loxodonta africana (African savanna elephant): 100669366
Entry
100669366         CDS       T04351                                 

Gene name
DAPK1
Definition
(RefSeq) death-associated protein kinase 1 isoform X2
  KO
K08803  death-associated protein kinase [EC:2.7.11.1]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04140  Autophagy - animal
lav05200  Pathways in cancer
lav05219  Bladder cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100669366 (DAPK1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100669366 (DAPK1)
  09162 Cancer: specific types
   05219 Bladder cancer
    100669366 (DAPK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lav01001]
    100669366 (DAPK1)
Enzymes [BR:lav01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100669366 (DAPK1)
Protein kinases [BR:lav01001]
 Serine/threonine kinases: CAMK group
  DAPK family
   100669366 (DAPK1)
SSDB
Motif
Pfam: Pkinase Ank_2 Ank_5 Ank_4 Ank PK_Tyr_Ser-Thr Ank_3 Death COR Kdo RIO1 O_Spanin_T7 AAA_23 APH ABC_tran Choline_kinase
Other DBs
NCBI-GeneID: 100669366
NCBI-ProteinID: XP_003407801
UniProt: G3T4R5
LinkDB
Position
Unknown
AA seq 1430 aa
MTVFRQENVDDYYDTGEELGSGQFAVVKKCREKSTGLQYAAKFIKKRRTKSSRRGVSRED
IEREVSILKEVQHPNVITLHEVYENKTDVILILELVAGGELFDFLAEKESLTEEEATEFL
KQILNGVYYLHSLQIAHFDLKPENIMLLDRHVPKPRIKIIDFGLAHKIDFGNEFKNIFGT
PEFVAPEIVNYEPLGLEADMWSIGVITYILLSGASPFLGDTKQETLANVSAVNYEFEEEY
FSNTSALAKDFIRRLLVKDPKKRMTIQDSLQHPWIKPKDTQQALSRKASAVNMEKFKKFA
ARKKWKQSVRLISLCQRLSRSFLSRSNMSVARSDDTLDEEDSFVMKAIIHAINDDNVPGL
QHLLGSLSNYDVNQPNKHGTPPLLIAAGCGNIQILQLLIKRGSRIDIQDKGGSNAIYWAS
RHGHVDTLKFLNENKCPLDVKDKSGETALHVAARYGHADVVQLLCSFGSNPNIQDKEEET
PLHCAAWHGYYSVAKALCEAGCNVNIKNREGETPLLTASARGYHDIVECLADHGADLDAS
DKDGHIALHLAVRRCQMEVIKTLLGQGCFVDFQDRHGNTPLHVACKDGNMPIVVALCDAN
CNLDISNKYGRTPLHLAANNGILDVVRYLCLTGANVEALTSDGKTAEDLAKSEQHQHVAG
LLARLRKDTHRGLFIQQLRPTQNLQPRIKLKLFGHSGSGKTTLVESLKCGLLRSFFRRRR
PRLSSTNSTRFPPSPLASKPTVSVSTNNLYPGCENVSVRSRSMMFEPGLTKGMLEVFVAP
PPHPHCSADDQATKAIDIQNAYLNGVGDFSVWEFSGNPVYFCCYDYFAANDPTSVHIIVF
SLEEPYEIQLNQVIFWLSFLKSLVPVEEPIAFGGKLKNPLRVVLVATHADIMNVPRPAGG
EFGYDKDTSLLKEIRNRFGNDLHISNKLFVLDAGASGSKDMKVLRNHLQEIRSQIVSVCP
PMTHLCEKIISTLPSWRKLGGPNQLMSLQQFMYDVQDQLNPLASEEDLRHMAQQLHSIGE
INIMQSETVQDVLLLDPRWLCTTVLGKLLSVETPRALHHYRGRYTVEDIQRLVPDSDVEE
LLQILDAMDICARDLSSGTMVDIPALIKTDNLHRSWTDEEDEVMVYGGVRVVPVEHLTPF
PCGIFHKVQVNLCRWIHQQSAEGDADIRLWVNGCKIANRGAELLVLLVNHGQGIEVQVRG
LETEKIKCCLLLDSVCSTIENVMATTLPGLLTVKHYLSPQQLREHHEPVMIYQPRDFFRA
QTLKEASLTNTMGGYKESFSSIMCFGCHDVYSQASLGMDIHASDLNLLTRRKLSRLLDPP
DPMGKDWCLLAMNLGLPDLVAKYNTNNGSSKDFLPSPVHALLREWTTYPESTVGILMSKL
RELGRRDAADFLLKASSVFKINLDVNGQEAYASSCNSGTSYNSISSVVSR
NT seq 4293 nt   +upstreamnt  +downstreamnt
atgaccgtgttcaggcaggaaaacgtggatgattactacgataccggcgaggaacttggc
agcgggcagtttgcagtcgtgaagaagtgccgggagaaaagcactggcctccagtatgcg
gccaaatttatcaagaaaaggaggacgaaatccagccggcggggcgtgagccgcgaggac
atcgagcgggaggtcagcatcctgaaggaggtccagcaccccaacgtcatcaccctgcac
gaagtctatgagaacaagacagatgtcatcctgattctagagcttgttgcaggtggcgag
ctgttcgacttcttagctgagaaggaatctttgactgaagaggaagcaacggaattcctc
aaacaaatcctcaatggtgtttactacctgcactcccttcagattgcacacttcgatctt
aagcctgaaaacataatgcttttggatagacatgtccccaaacctcggatcaagatcatt
gactttgggttggcccataaaattgactttggaaatgaattcaaaaacatatttgggaca
ccagagtttgttgctcctgagatagtcaactatgaaccccttggtctcgaggcggacatg
tggagcattggggtaataacctatattctcttaagtggggcctccccgtttcttggagac
acaaagcaagaaacattagcaaatgtatctgccgtcaactatgaatttgaggaagaatac
ttcagtaataccagtgccctagccaaagatttcataaggagacttctggtcaaggatcca
aagaagagaatgacaattcaagacagtttgcagcacccctggatcaagcctaaagacaca
cagcaagcacttagcagaaaagcgtcagcagtaaacatggagaaattcaagaagttcgca
gcccgaaaaaaatggaaacaatcggttcgcttgatatcactgtgccaaagattatccagg
tcattcctgtccagaagcaacatgagtgttgccagaagtgatgatactctggatgaggaa
gactcctttgtgatgaaagccatcattcatgccatcaacgatgacaatgtcccaggtctg
cagcaccttctgggctctttgtctaactacgatgttaaccaacccaacaagcatgggaca
cctccgttacttattgcggctggctgcgggaatattcaaatactgcagttgctcattaaa
agaggctcaagaattgatatccaggataagggcggatccaatgccatctactgggcctct
cggcatggccacgtggataccttgaaatttctcaatgagaacaaatgccctttggatgtt
aaagacaagtctggagagacggcccttcatgtggcagctcgctacggccatgccgacgtg
gttcagttactctgcagtttcggctccaatcccaatatccaggacaaggaggaagaaacc
cccctgcactgtgccgcctggcacggctattactctgtggccaaagccctttgtgaagcc
ggctgtaacgtgaacattaagaatcgtgaaggagagacacccctccttacagcttcagcc
cggggctaccacgacatcgtggagtgtctggctgaccacggcgccgaccttgatgcctcc
gacaaggatggacacattgctcttcatcttgccgtacgacggtgtcaaatggaggtcatc
aagactctgcttggccaaggatgtttcgtggatttccaagacagacacggcaacaccccc
ctgcacgtggcctgcaaagatggcaacatgcccattgtggtggccctctgtgatgcaaac
tgcaatttggacatctcaaacaagtatggccgaacccctctacatcttgcagccaacaac
gggattctggatgtggtccggtacctctgtctgaccggtgccaacgtggaagccctcacc
tctgatggcaagaccgcagaagaccttgcgaagtcggaacagcatcagcatgtagccggt
ctccttgccagactccgaaaggatacccaccgaggtctcttcatccagcagcttcgaccc
acgcagaacctccagccgagaatcaaactcaagctgtttggccactcggggtctgggaaa
accaccctggtggagtccctcaagtgcgggctgctgaggagcttcttccggaggcggcgg
cccaggctctcctccaccaactccaccaggttccccccatcgcccttggcttccaagcca
acagtctccgtgagcaccaacaacctgtaccccggctgtgagaatgtgagtgtgaggagt
cgcagcatgatgttcgagccggggctcaccaaagggatgctggaggtgttcgtggccccg
ccgccccacccgcactgctccgccgatgaccaggccaccaaggccattgacatccagaac
gcctatttgaacggagtcggtgatttcagtgtgtgggagttctctggaaatcctgtgtat
ttctgctgttacgattattttgctgccaacgatcccacctcagtccatatcatcgttttc
agtctagaagaaccctatgagatccagctgaaccaagtgattttctggctgagtttcctg
aagtctcttgttcccgttgaagagcccatagcctttggtggtaagctgaagaaccccctc
cgagttgtcctggtggccacccacgccgacatcatgaacgtccctcgtccagctggaggc
gagtttggttatgacaaagatacatcgttgctgaaagagatcaggaacaggtttgggaat
gaccttcacatttcaaataagctgtttgttctggatgctggggcttccgggtctaaggat
atgaaggtacttcgaaatcacctgcaagaaatacggagccagatcgtttctgtctgccct
ccgatgacccacctgtgtgagaagatcatctcgacgctgccttcctggaggaaactcggt
gggcccaaccagctgatgtcactgcagcagttcatgtacgatgtgcaggaccagctgaac
cccctggccagcgaggaggacctcaggcacatggcccagcagctccatagcatcggcgag
atcaacatcatgcagagtgaaacagtccaggatgtactgctcctggacccccgctggctg
tgcaccacagtcctggggaagctgctctccgttgagaccccccgggccctgcaccactac
cgtggccgctacaccgtggaggacattcagcgcctggttcccgacagcgacgtggaggag
ctgcttcagatcctggatgccatggacatctgcgcccgggacctgagcagtggcaccatg
gtggatatccccgccctgatcaagacggacaacctgcatcgctcctggacggacgaggag
gacgaggtgatggtctacggaggcgtgcgtgttgtccccgtggagcacctcacccccttc
ccctgcggcatctttcacaaggtccaggtcaacctgtgccggtggatccaccagcagagc
gccgagggcgacgcggacatccgtctgtgggtgaacggctgcaagattgccaaccgcgga
gctgagctgctggtgctcctggtcaaccacggccagggcatcgaggtccaggtccgcggt
ctggagacggaaaagatcaagtgctgcctcctactggactcagtgtgcagcaccatcgag
aacgtcatggccaccacgctgccggggctactgactgtgaagcattacctgagcccgcag
cagctgagggagcaccacgaacctgtcatgatctaccagccgcgggacttcttccgggca
cagaccctgaaggaggcctcactgacgaacaccatggggggttacaaggagagcttcagt
agcatcatgtgctttgggtgtcatgacgtctactcacaggccagcctcgggatggacatc
cacgcttcagatctgaacctcctgacccggcggaaactgagtcgcctactggacccaccc
gatcccatggggaaggactggtgccttctcgccatgaacttgggcctcccggacctcgtg
gcaaagtacaacaccaacaatgggtcttccaaggacttccttccaagcccagtccatgcc
ctgctccgggagtggaccacctaccctgagagcacggtcggcatcctcatgtctaaacta
agggagctaggtcgccgggacgctgccgactttttactgaaggcgtcctctgtgttcaaa
ataaacctcgatgtcaatggccaggaggcctatgcctcaagttgcaacagtggcacatca
tataattccattagttcagtggtgtcccggtga

KEGG   Loxodonta africana (African savanna elephant): 100670001
Entry
100670001         CDS       T04351                                 

Gene name
DAPK3
Definition
(RefSeq) death-associated protein kinase 3 isoform X2
  KO
K08803  death-associated protein kinase [EC:2.7.11.1]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04140  Autophagy - animal
lav05200  Pathways in cancer
lav05219  Bladder cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100670001 (DAPK3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100670001 (DAPK3)
  09162 Cancer: specific types
   05219 Bladder cancer
    100670001 (DAPK3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lav01001]
    100670001 (DAPK3)
Enzymes [BR:lav01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100670001 (DAPK3)
Protein kinases [BR:lav01001]
 Serine/threonine kinases: CAMK group
  DAPK family
   100670001 (DAPK3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo RIO1 Choline_kinase APH DUF3847
Other DBs
NCBI-GeneID: 100670001
NCBI-ProteinID: XP_003421940
LinkDB
Position
Unknown
AA seq 454 aa
MSTFRQEDVEDHYEMGEELGSGQFAIVRKCRQKGTGKEYAAKFIKKRRLSSSRRGVSREE
IEREVNILREIRHPNIITLHDIFENKTDVVLILELVSGGELFDFLAEKESLTEDEATQFL
KQILDGVHYLHSKRIAHFDLKPENIMLLDKDVPNPRIKLIDFGIAHKIEAGNEFKNIFGT
PEFVAPEIVNYEPLGLEADMWSIGVITYILLSGASPFLGETKQETLTNISAVNYDFDEEY
FSNTSELAKDFIRRLLVKDPKRRMTIAQSLEHSWIKAIKRRNVRSEESGRKPERRRLKTT
RLKEYTIKSHSSMPPNNTYVNFERFSKVLEEVAAAEEGLRELERSRRLFREDIEALTAIY
VEKEAWYKEENESIGRDLRRLRQELHKAEALKRQAQEETKGALLGASGLKRRFSRLENRY
EALAKQVASEMHFVQELVRSLELEKLQAGECGLR
NT seq 1365 nt   +upstreamnt  +downstreamnt
atgtctacattcaggcaggaagacgtggaggaccactatgagatgggggaggaactgggc
agcggccagtttgccatcgtgcggaagtgccggcagaagggcaccgggaaggagtacgcc
gccaagttcatcaagaagcgccgcctgtcatccagccggcggggtgtgagccgcgaggag
atcgagcgggaggtgaacatcctgcgggagatccggcaccccaacatcatcacgctgcac
gacatcttcgagaacaagacagacgtggtgctcatcctggagctggtctcgggcggcgag
ctctttgacttcctggctgagaaggaatctctgaccgaggatgaagccacccagttcctc
aagcagatcctggatggtgtccactatctgcactccaaacgcatcgcccacttcgacctc
aagccagagaacatcatgctgttggacaaggacgtgcccaatccacgcatcaagctcatt
gactttggcatcgcccacaagattgaggctggcaacgagttcaaaaacatcttcggcacc
cctgagttcgtggctcctgagattgtcaactatgagcccctggggctggaggctgacatg
tggagtattggcgtcatcacctacatcctcttaagtggtgcgtccccattcctgggggag
accaagcaggagacgctgaccaacatttcggcggtgaactacgactttgacgaggagtac
ttcagcaacaccagcgagctggccaaggacttcatccgccggctgctcgtcaaagacccc
aagcggagaatgactatcgctcagagcctggagcattcctggatcaaggcaatcaagcgt
cggaacgtgcggagtgaggagagtggccggaagccggagcgccggcggctgaagaccaca
cgcctcaaggagtacaccatcaagtcgcactccagcatgccgcccaacaacacctacgtc
aacttcgagcgcttctccaaggtgctggaggaggtggcagcggccgaggagggcctgcgc
gagctggaacgcagcaggcggctcttccgcgaggacatcgaggcgctaacggccatctat
gtggagaaggaggcctggtacaaggaggagaacgagagcatcggccgggacctccggcgg
ctgcgccaggagctgcacaaggccgaggcgctcaagcggcaggcccaggaggagaccaag
ggtgccctgctcggcgccagtggcctcaagcgccgcttcagccgcctggagaaccgctat
gaggccctggccaagcaggtggcgtccgagatgcacttcgtgcaggagctggtgcgcagc
ctggagctggagaagctgcaggccggcgagtgcggcctgcgctag

DBGET integrated database retrieval system