KEGG   Loxodonta africana (African savanna elephant): 100669277
Entry
100669277         CDS       T04351                                 

Gene name
MRAP
Definition
(RefSeq) melanocortin-2 receptor accessory protein
  KO
K22398  melanocortin 2 receptor accessory protein
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04927  Cortisol synthesis and secretion
lav04934  Cushing syndrome
Brite
KEGG Orthology (KO) [BR:lav00001]
 09150 Organismal Systems
  09152 Endocrine system
   04927 Cortisol synthesis and secretion
    100669277 (MRAP)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100669277 (MRAP)
SSDB
Motif
Pfam: MRAP FixQ T4SS_pilin
Other DBs
NCBI-GeneID: 100669277
NCBI-ProteinID: XP_003410205
LinkDB
Position
Unknown
AA seq 156 aa
MANGTNASGPYYSYEYYLDYLDLISVDEKKLRANKHSIVIAFWVSLAAFVVLLFLILLYM
SWSGSPETRNHPQHHPACPWNHFLNFPLCVRRHPQRHKGPPGAPLNPGSEKEPGRGSDPE
QPLHPGGPSAVAPTPSQSLPALLWELAHDGGPHSIS
NT seq 471 nt   +upstreamnt  +downstreamnt
atggccaacgggaccaacgcctctggcccgtactacagctacgagtactacctggactac
ctggacctcatttctgtggacgagaagaagctgagagccaacaagcattcgatcgtcatt
gccttctgggtgagcctggctgcctttgtggtgctcctcttcctcatcttgctctacatg
tcttggtcgggctcccctgagacaaggaaccaccctcagcaccacccagcatgtccgtgg
aatcacttcctcaacttccccctctgcgtccggaggcacccacagcgccacaagggccct
ccaggggcccccctgaatcctggctcagagaaggaaccaggaagaggctcagaccctgag
cagccgctgcatccggggggcccctccgctgtggcccccacaccatcccagtctctccct
gctctcctctgggaactggcccatgatgggggcccccacagcatcagctga

DBGET integrated database retrieval system