KEGG   Loxodonta africana (African savanna elephant): 100669326
Entry
100669326         CDS       T04351                                 

Gene name
ORAI1
Definition
(RefSeq) calcium release-activated calcium channel protein 1
  KO
K16056  calcium release-activated calcium channel protein 1
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04020  Calcium signaling pathway
lav04024  cAMP signaling pathway
lav04611  Platelet activation
lav04924  Renin secretion
lav04925  Aldosterone synthesis and secretion
lav04927  Cortisol synthesis and secretion
lav04934  Cushing syndrome
lav05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    100669326 (ORAI1)
   04024 cAMP signaling pathway
    100669326 (ORAI1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100669326 (ORAI1)
  09152 Endocrine system
   04924 Renin secretion
    100669326 (ORAI1)
   04925 Aldosterone synthesis and secretion
    100669326 (ORAI1)
   04927 Cortisol synthesis and secretion
    100669326 (ORAI1)
 09160 Human Diseases
  09163 Immune disease
   05340 Primary immunodeficiency
    100669326 (ORAI1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100669326 (ORAI1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:lav04040]
    100669326 (ORAI1)
Ion channels [BR:lav04040]
 Other channels
  Calcium channel, calcium release-activated (Orai)
   100669326 (ORAI1)
SSDB
Motif
Pfam: Orai-1 RTA1 m04gp34like YrhC
Other DBs
NCBI-GeneID: 100669326
NCBI-ProteinID: XP_010598162
LinkDB
Position
Unknown
AA seq 218 aa
MAVIWHSPCLFLSPQVAMVEVQLDADHDYPPGLLIAFSACTTVLVAVHLFALMISTCILP
NIEAVSNVHNLNSVKESPHERMHRHIELAWAFSTVIGTLLFLAEVVLLCWVKFLPLKKQP
GQPRPTSKPPDGGGVLNVSSSSPEGITPGQAAAIASTTIMVPFGLVFIVFAVHFYRSLVS
HKTDRQFQELNELAEFARLQDQLDHRGDHPLTPGSHYA
NT seq 657 nt   +upstreamnt  +downstreamnt
atggctgtcatctggcactcaccctgcctgttcttgtccccacaggtggcgatggtggag
gtgcagctggatgctgaccacgactacccaccagggctgcttatcgccttcagtgcctgc
accacagtgctggtggccgtgcacctgtttgcactcatgatcagcacttgcatcctgccc
aacattgaggccgtgagcaacgtgcataacctcaactctgtcaaggagtcgccccacgag
cgcatgcaccgccacattgagctggcctgggccttctccactgtcattggcacactgctc
ttcctggccgaggtggtgctgctctgctgggtcaagttcctgcccctcaagaagcagcca
ggtcagccacggcccacgagcaagcccccagatggcggcggggtcctcaatgtcagcagc
agcagccccgagggcatcaccccaggccaggcagctgccatcgcctccaccaccataatg
gtccccttcggcctggtctttatcgtctttgccgtccacttttaccgctcgctggtcagc
cacaagacagaccgacagttccaggagctcaacgaactagccgagtttgctcgcctgcag
gaccagctggaccacagaggggaccaccccctgacacccggcagccactatgcctga

DBGET integrated database retrieval system