KEGG   Loxodonta africana (African savanna elephant): 100669404
Entry
100669404         CDS       T04351                                 

Gene name
MLH1
Definition
(RefSeq) DNA mismatch repair protein Mlh1 isoform X1
  KO
K08734  DNA mismatch repair protein MLH1
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav01524  Platinum drug resistance
lav03430  Mismatch repair
lav03460  Fanconi anemia pathway
lav05200  Pathways in cancer
lav05210  Colorectal cancer
lav05213  Endometrial cancer
lav05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03430 Mismatch repair
    100669404 (MLH1)
   03460 Fanconi anemia pathway
    100669404 (MLH1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100669404 (MLH1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100669404 (MLH1)
   05226 Gastric cancer
    100669404 (MLH1)
   05213 Endometrial cancer
    100669404 (MLH1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100669404 (MLH1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:lav03400]
    100669404 (MLH1)
DNA repair and recombination proteins [BR:lav03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    MutL homologs
     100669404 (MLH1)
SSDB
Motif
Pfam: Mlh1_C DNA_mis_repair HATPase_c_3 HATPase_c
Other DBs
NCBI-GeneID: 100669404
NCBI-ProteinID: XP_003415755
LinkDB
Position
Unknown
AA seq 754 aa
MSFVAGVIRRLDETVVNRIAAGEVIQRPANAIKEMIENCLDAKSTSIQVVVKEGGLKLIQ
IQDNGTGIRKEDLDIVCERFTTSKLQSFEDLARISTYGFRGEALASISHVAHVTITTKTA
DGKCAFRANYSDGKLKAPPNPCAGNQGTQIVVEDLFYNIATRRKALKNPSEEYGKILEVV
GRYSIHNSGISFSVKKHGETAADVRTLSNATTVDNIRSIFGNAVSRYVDNLCQNLLRSLS
GFISNANYSVKKCIFLLFINHRLVESASLRKAIETVYAAYLPKNTHPFLYLSLEISPQNV
DVNVHPTKHEVHFLHEDSILERVQQHIESKLLGSNSSRTYFTQTLLPGPAGPSGEVVKST
VSGAPSSASGSGDKVYAHQMVRTDSREQKLDAFLQPVSKGVSSWPQAQVPEDNTDGSSGR
ARQQDEEMLELPAPAQVAAENQGMEEEATKEPSETEKRGPTLSPGVPRKRPRGDSDVEML
EDDSQKEMTAACTPRRRIINLTSVLNLQEEINERGHEALREMLYNHSFVGCVNPQWALAQ
YQTKLYLLNTTKLSEELFYQILIYDFANFGVLRLSEPAPLFDLAMLALDSPESGWTEEDG
PKEGLAEYIVEFLKKKAEMLTDYFSLEIDKEGNLIGLPLLIDNYVPPLEGLPIFILRLAT
EVNWDEEKECFESLSKECALFYSIRQQYVCEGSTLSGQQSEVPGSAAKPWKWTVEHVVYK
AFRSHLLPPKHFTEDGNILQLANLPDLYRVFERC
NT seq 2265 nt   +upstreamnt  +downstreamnt
atgtcgttcgtggcgggggtgatccgccggctagacgagacagtggtgaaccgcatcgcg
gcgggagaggttatccagcgaccggctaatgccatcaaggagatgattgagaactgttta
gatgcgaaatctacaagtattcaagtggttgtgaaagagggaggcctgaaattgattcag
atccaagacaacggcactgggatcaggaaggaagatctggacattgtgtgtgagaggttc
actacaagtaaactgcagtcctttgaggatttagcccgtatttctacctatggcttccgg
ggcgaggctttggccagcatcagccacgtggctcacgttactattacgaccaaaacagcc
gatggaaaatgtgcgttcagggcaaattactcagatggaaagctgaaggcgcctcctaac
ccgtgtgcgggcaatcaggggacccagatcgtggtggaggaccttttttataacatagcc
acgaggaggaaagcgttaaaaaatccaagtgaagagtatgggaagattttggaagttgtt
ggcaggtattcaatacacaattcaggcattagtttctcagttaaaaaacacggtgagacg
gcggctgacgttagaacgctgtccaacgccacaactgtggacaacattcgctccatcttt
ggaaatgctgttagtcggtatgttgataacctctgtcaaaatcttctgcgttccttgtct
gggtttatatccaatgcaaactactcggtgaagaagtgcatcttcttactcttcatcaac
catcgtctggttgaatcagcctccttgagaaaagccatagaaacggtttacgcggcatac
ctgcccaaaaacacacacccattcctgtacctcagtttagaaatcagcccccagaacgtg
gatgtcaacgtgcacccaacgaagcatgaggtccacttcctgcacgaggacagcatcctg
gagcgagtacagcagcacatcgagagcaagcttctgggctccaactcctccaggacatac
ttcacccagactttgctgccaggacctgctggcccctctggggaggtggttaagtccaca
gtcagtggggccccttcttctgcttctggaagtggagacaaggtctacgcccaccagatg
gttcgtacagattcccgggaacagaaactcgatgcctttctgcagcctgtgagcaagggt
gtgtccagctggccgcaggcccaagtcccagaggacaacacagatggttctagtggcagg
gccaggcagcaagatgaggagatgctcgaactcccagcccctgcccaagtggctgccgag
aaccagggaatggaagaggaagcaacaaaggagccttcagaaacagagaagagggggccc
accctgagcccaggtgttcccaggaagaggcctcggggagactctgatgtggagatgttg
gaagacgattctcaaaaggaaatgacagcagcctgcaccccgcggcgaaggattattaac
ctcaccagcgttttgaatctccaggaagaaattaacgagcgagggcatgaggctctccgg
gagatgctgtataaccactcctttgtgggctgtgtgaaccctcagtgggccctggcacag
tatcagaccaagctatacctgctcaacaccaccaagctcagtgaggaactgttctaccag
atactcatttatgacttcgccaattttggtgttctgagattatcggagccagcaccactc
ttcgacctcgccatgctggctttagacagtcccgagagcggctggacagaggaggatggc
cccaaagaaggacttgccgaatacattgttgagtttctgaagaagaaggctgagatgctt
acagactatttctctctggaaattgataaggaagggaacctgattggattaccccttctg
attgacaactatgtgccccctctggagggactgcctatcttcatccttcgactggccact
gaggtgaattgggatgaagaaaaggagtgtttcgaaagcctcagtaaagaatgtgcgctg
ttttactccatccggcagcagtatgtatgtgaggggtccaccctctccggccagcagagt
gaagtgcctggctctgctgcaaagccctggaagtggactgtggagcacgtcgtctataaa
gccttccgctcacacctcctgcctcctaaacatttcacagaagatgggaatatcctgcag
cttgctaacctgcctgatctatacagagtctttgagaggtgctaa

DBGET integrated database retrieval system