KEGG   Loxodonta africana (African savanna elephant): 100669421Help
Entry
100669421         CDS       T04351                                 

Gene name
ACADS
Definition
(RefSeq) LOW QUALITY PROTEIN: short-chain specific acyl-CoA dehydrogenase, mitochondrial
  KO
K00248  butyryl-CoA dehydrogenase [EC:1.3.8.1]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav00071  Fatty acid degradation
lav00280  Valine, leucine and isoleucine degradation
lav00410  beta-Alanine metabolism
lav00640  Propanoate metabolism
lav00650  Butanoate metabolism
lav01100  Metabolic pathways
lav01200  Carbon metabolism
lav01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:lav00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    100669421 (ACADS)
   00650 Butanoate metabolism
    100669421 (ACADS)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    100669421 (ACADS)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    100669421 (ACADS)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    100669421 (ACADS)
Enzymes [BR:lav01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.8  With a flavin as acceptor
    1.3.8.1  short-chain acyl-CoA dehydrogenase
     100669421 (ACADS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Acyl-CoA_dh_1 Acyl-CoA_dh_N Acyl-CoA_dh_2 Acyl-CoA_dh_M
Motif
Other DBs
NCBI-GeneID: 100669421
NCBI-ProteinID: XP_003419368
LinkDB All DBs
Position
Unknown
AA seq 489 aa AA seqDB search
MEDGTDNKLKDLGGCTQAGRGRRGLSGPAPAGARDRRAPPPVVRNPSVGSGRSSGGSEVL
STWAMAMTAALFARACGRVRGVLHPRDWRQLHTIYQSVALPETHLMLRETCRDFAEKELV
PIAAQLDKEHRFPAAQVKRMGELGLLAMDVPEELGGASLDYLAYSIAVEEISRGCASTGA
IMSVNNSLYLGPILKFGSQEQKQRWVTPFTSGDKLGCFALSEPGNGSDAGAASTTAVADG
DSWVLNGTKAWITNSWEASAAXVFASTDRLQQNKVGAPQRASRTLGYSQFIVPMPTPGLT
LGKKEDKLGIRASSTANLIFEDCRIPKENLLGELGMGFKIAMQTLDAGRIGIASQALGIA
QAALDCAVTYAENRKAFGMPLTKLQVIQFKLADMALALESARLLTWRAAMLKDDKKPFVK
EAAMAKLAASEAATAITHQAIQILGGMGYVTEMPAERHYRDARITEIYEGTSEIQRLVVA
RHVLKSYQS
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atggaagacggcacggacaacaagctgaaggatcttggaggctgcactcaggcaggacgc
gggaggcggggcctctcaggccccgccccggctggagcacgtgaccgccgcgccccgccc
cccgtagtccggaacccgagcgtcgggagcgggaggtcttccgggggaagcgaggtgttg
tcaacgtgggccatggccatgaccgctgcgctgttcgcccgggcctgcggccgagtccgc
ggagttctgcatcctcgggactggcggcagttacatacgatctaccagtcggtggcattg
cccgagacacatctgatgttgcgcgagacgtgccgggactttgccgagaaggagctggtt
cccattgccgcccagctggacaaggaacatcgcttcccagcagctcaggtgaaaaggatg
ggtgagctggggctgctggccatggacgtgccggaggagctgggtggtgctagcctcgac
tacctggcctactccattgccgtggaggagatcagcaggggctgcgcctccactggcgcc
atcatgagtgtcaacaattcgctgtatctggggcctatcctgaagtttggctcccaggag
cagaagcagcggtgggtcactcctttcaccagtggtgataaacttggctgcttcgccctc
agtgaaccagggaacggcagcgacgcgggcgccgcctccaccacggccgtcgcagacggt
gactcctgggtcctgaatggtaccaaggcctggatcactaactcttgggaggcctccgcc
gccngtgtcttcgccagcacggacagactccagcaaaacaaggtgggcgccccacaaagg
gccagtcggaccctgggctacagtcaattcatagttcccatgccaacgcctgggctcacg
ctgggcaagaaggaagacaagctgggcattcgggcctcgtccacggccaacctcatcttt
gaggactgtcgcatccccaaggaaaacctgctaggggagctgggaatgggcttcaagatt
gccatgcaaaccctggatgcgggccgcattggcattgcctcccaggccctgggcatcgcc
caggctgcccttgactgtgccgtgacctacgccgagaaccgcaaggcctttgggatgccc
ctcaccaagcttcaggtcatccagttcaagttggcggacatggccctggccctggaaagt
gcccggctgctgacctggcgcgctgccatgctgaaggacgataagaaacctttcgtcaag
gaggctgcaatggccaagctggctgcatcggaggctgccaccgccatcacccaccaggcc
atccaaatccttggtggcatgggctatgtgacagagatgccggccgagcgacactaccgt
gacgcccgcatcactgagatttacgaaggcaccagcgagatccagaggctggtggtcgct
aggcatgtgctcaagagctaccagagctga

DBGET integrated database retrieval system