KEGG   Loxodonta africana (African savanna elephant): 100669677
Entry
100669677         CDS       T04351                                 

Gene name
SGCA
Definition
(RefSeq) LOW QUALITY PROTEIN: alpha-sarcoglycan
  KO
K12565  alpha-sarcoglycan
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav05410  Hypertrophic cardiomyopathy
lav05412  Arrhythmogenic right ventricular cardiomyopathy
lav05414  Dilated cardiomyopathy
lav05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:lav00001]
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    100669677 (SGCA)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    100669677 (SGCA)
   05414 Dilated cardiomyopathy
    100669677 (SGCA)
   05416 Viral myocarditis
    100669677 (SGCA)
SSDB
Motif
Pfam: Sarcoglycan_2
Other DBs
NCBI-GeneID: 100669677
NCBI-ProteinID: XP_023409156
LinkDB
Position
Unknown
AA seq 488 aa
MPERRSCPLQEILNINTPCLQLPRIFWGSSWSEGDLPSPPPKGSFTPASWCLKFPFAPAG
TPPLGKLGLRPSALSLSLFVTVHSHSRATWEVQTHLGASRKRREGVRPPPHLPWLRGTSL
PPLPASIPTGSTRILQEGLAPGTGLLAGLAGTKAQQTTLHPLVGRIFVHTLDHATFLRLP
EHVAAIPPSTRITYHAHLQGHPDLPRWLRYTQRSPYHPGFLYGTATSEDRGRQVIEVVAY
NRDSFETTWQRLVLMIGDPEALGGLWEPGELQLINITSALDRGGRVPLPIEGRKEGVYIK
VGSASPFSTCLKMVASPDSHARCAQGQPPLLSCYDTLAPHFRVAWCNVSLVDKSVPEPMD
EMPTPGDGILEQDPFFCPPTEATARDFLTDALVTLLVPLLVALLLTLLLAYIMCCRREGR
LKRDLVTSDIQMVHHGTIRENTEELRQMAASREVPRPLSTLPMFNVRTGERLPPRVDSAQ
VPLILDQH
NT seq 1467 nt   +upstreamnt  +downstreamnt
atgccagaaaggcgttcatgtccattacaagaaattctaaatataaacaccccctgcctg
cagcttccacgaatcttttggggatcatcctggagcgaaggtgacctcccttctccacct
cccaaggggtctttcactcctgcttcttggtgcctcaagttcccctttgcccctgcaggg
actcctcccttggggaaactgggcctgcgtccctctgctctgtccctctctctttttgtt
actgtccatagtcactcaagagccacttgggaagttcagacacatcttggagcctcaaga
aagagaagagaaggagtcaggcctccacctcacctgccctggctcaggggaacaagcctc
ccgcccttgccagcttccatcccgactggctccaccaggatcctccaggaaggcttggca
cctggcacaggtctcctggcagggctggcaggcaccaaggcccagcagaccaccctccat
cctcttgtgggtcgcatctttgtacacaccttggatcacgccaccttccttcgccttcct
gagcatgttgcagctatcccaccttccacccgcatcacctatcatgcccacctccaggga
cacccagacctgccgcggtggctccgctacacccagcgtagcccctaccaccctggcttc
ctctatggcactgccacctcagaagatcgcggccgccaggtcatcgaggtcgtagcctac
aatcgggacagctttgagaccacctggcagagactggtgctgatgattggggacccggaa
gccctgggggggctctgggagccgggggagctccagcttataaatatcacctccgccttg
gaccgtgggggccgtgtgccccttccaattgagggccgcaaagaaggggtgtacatcaag
gtgggctcagcctcacccttctccacctgtctgaagatggtggcgtcccctgacagccat
gcccgctgtgcccagggccagcctccacttctgtcctgctacgacaccttggcaccccac
ttccgtgttgcttggtgcaatgtgtccctggtggataagtcagtgccagagcccatggac
gagatgcccaccccaggtgatgggatcctggagcaggacccgttcttctgcccacccact
gaggccacagcccgagacttcctgactgacgcactggtcaccctcctggtgcccctgctg
gtggccctgctgctcaccctgctgctggcctacatcatgtgctgtcgacgggagggacgg
ctgaagagagacctggtcacctctgacatccagatggtccaccatggcaccatccgtgag
aacacggaggagctgcggcagatggcagccagccgcgaggtgccccggccactctccacc
ctgcccatgttcaacgtgcgcacgggtgaacggctgcctcctcgtgtggacagcgcccag
gtgcccctcatcctggaccagcactga

DBGET integrated database retrieval system