KEGG   Loxodonta africana (African savanna elephant): 100669703
Entry
100669703         CDS       T04351                                 

Gene name
CCND1
Definition
(RefSeq) G1/S-specific cyclin-D1
  KO
K04503  G1/S-specific cyclin-D1
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav01522  Endocrine resistance
lav04068  FoxO signaling pathway
lav04110  Cell cycle
lav04115  p53 signaling pathway
lav04151  PI3K-Akt signaling pathway
lav04152  AMPK signaling pathway
lav04218  Cellular senescence
lav04310  Wnt signaling pathway
lav04340  Hedgehog signaling pathway
lav04371  Apelin signaling pathway
lav04390  Hippo signaling pathway
lav04510  Focal adhesion
lav04530  Tight junction
lav04630  JAK-STAT signaling pathway
lav04917  Prolactin signaling pathway
lav04919  Thyroid hormone signaling pathway
lav04921  Oxytocin signaling pathway
lav04933  AGE-RAGE signaling pathway in diabetic complications
lav04934  Cushing syndrome
lav05160  Hepatitis C
lav05162  Measles
lav05163  Human cytomegalovirus infection
lav05165  Human papillomavirus infection
lav05166  Human T-cell leukemia virus 1 infection
lav05167  Kaposi sarcoma-associated herpesvirus infection
lav05169  Epstein-Barr virus infection
lav05200  Pathways in cancer
lav05203  Viral carcinogenesis
lav05205  Proteoglycans in cancer
lav05206  MicroRNAs in cancer
lav05210  Colorectal cancer
lav05212  Pancreatic cancer
lav05213  Endometrial cancer
lav05214  Glioma
lav05215  Prostate cancer
lav05216  Thyroid cancer
lav05218  Melanoma
lav05219  Bladder cancer
lav05220  Chronic myeloid leukemia
lav05221  Acute myeloid leukemia
lav05222  Small cell lung cancer
lav05223  Non-small cell lung cancer
lav05224  Breast cancer
lav05225  Hepatocellular carcinoma
lav05226  Gastric cancer
lav05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100669703 (CCND1)
   04340 Hedgehog signaling pathway
    100669703 (CCND1)
   04390 Hippo signaling pathway
    100669703 (CCND1)
   04371 Apelin signaling pathway
    100669703 (CCND1)
   04630 JAK-STAT signaling pathway
    100669703 (CCND1)
   04068 FoxO signaling pathway
    100669703 (CCND1)
   04151 PI3K-Akt signaling pathway
    100669703 (CCND1)
   04152 AMPK signaling pathway
    100669703 (CCND1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100669703 (CCND1)
   04115 p53 signaling pathway
    100669703 (CCND1)
   04218 Cellular senescence
    100669703 (CCND1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100669703 (CCND1)
   04530 Tight junction
    100669703 (CCND1)
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    100669703 (CCND1)
   04921 Oxytocin signaling pathway
    100669703 (CCND1)
   04919 Thyroid hormone signaling pathway
    100669703 (CCND1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100669703 (CCND1)
   05206 MicroRNAs in cancer
    100669703 (CCND1)
   05205 Proteoglycans in cancer
    100669703 (CCND1)
   05203 Viral carcinogenesis
    100669703 (CCND1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100669703 (CCND1)
   05212 Pancreatic cancer
    100669703 (CCND1)
   05225 Hepatocellular carcinoma
    100669703 (CCND1)
   05226 Gastric cancer
    100669703 (CCND1)
   05214 Glioma
    100669703 (CCND1)
   05216 Thyroid cancer
    100669703 (CCND1)
   05221 Acute myeloid leukemia
    100669703 (CCND1)
   05220 Chronic myeloid leukemia
    100669703 (CCND1)
   05218 Melanoma
    100669703 (CCND1)
   05219 Bladder cancer
    100669703 (CCND1)
   05215 Prostate cancer
    100669703 (CCND1)
   05213 Endometrial cancer
    100669703 (CCND1)
   05224 Breast cancer
    100669703 (CCND1)
   05222 Small cell lung cancer
    100669703 (CCND1)
   05223 Non-small cell lung cancer
    100669703 (CCND1)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100669703 (CCND1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100669703 (CCND1)
   04934 Cushing syndrome
    100669703 (CCND1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100669703 (CCND1)
   05162 Measles
    100669703 (CCND1)
   05160 Hepatitis C
    100669703 (CCND1)
   05163 Human cytomegalovirus infection
    100669703 (CCND1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100669703 (CCND1)
   05169 Epstein-Barr virus infection
    100669703 (CCND1)
   05165 Human papillomavirus infection
    100669703 (CCND1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100669703 (CCND1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 100669703
NCBI-ProteinID: XP_003419581
UniProt: G3T0G2
LinkDB
Position
Unknown
AA seq 295 aa
MEHQLLCCEVETIRRAYPDANLLNDRVLQAMLKAEETCAPSVSYFKCVQKEILPSMRKIV
ATWMLEVCEEQKCEEEVFPLAMNYLDRFLSLEPVKKSRLQLLGATCMFVASKMKETIPLT
AEKLCIYTDNSIRPDELLHMELLLVNKLKWNLAAMTPHDFIEHFLSKMPVAQENKQIIRK
HAQTFVALCATDVKFISNPPSMVAAGSVVAAVQGLHLGSTSGFLSYHRLTRFLSKVIKCD
PDCLRACQEQIEALLESSLRQAQQQSLDPKAAEEEEEEEEVDLACTPTDVRDVNI
NT seq 888 nt   +upstreamnt  +downstreamnt
atggagcaccagctcctgtgctgcgaggtggagaccatccgccgcgcgtaccccgatgcc
aaccttctcaacgaccgggtgctgcaggccatgctcaaggccgaagagacctgcgcaccc
tcggtgtcctacttcaagtgcgtgcagaaggagatactgccgtccatgcgcaagatcgtg
gccacctggatgctggaggtctgcgaggagcagaagtgcgaggaggaggtcttcccgctg
gccatgaactatctggaccgcttcctgtccctggagccggtgaagaagagccgcctgcag
ctgctgggggccacctgcatgttcgtggcctccaagatgaaggagaccatccccctgacg
gccgagaagctgtgcatctacacagacaactccatccgacccgacgagctgctgcacatg
gagctgcttctggtgaacaagctcaagtggaacctggctgccatgaccccccacgatttc
atcgaacacttcctgtccaagatgcccgtggcccaggagaacaagcagattatccgaaaa
cacgcccagaccttcgtggcgctctgtgccacagatgtgaagttcatttccaacccaccc
tccatggtggccgccgggagcgtggtagctgcggtgcagggtctgcatctgggaagtacc
agcggcttcctctcctaccaccgcctcacgcggttcctctccaaagtgatcaagtgtgac
ccggactgcctccgggcctgccaggagcagatcgaggccctgctggagtccagcctgcgc
caggcccagcaacagagcctggaccccaaggctgcggaggaggaagaggaggaagaggag
gtggacctggcctgcacccccaccgacgtgcgggacgtgaacatttga

DBGET integrated database retrieval system