KEGG   Loxodonta africana (African savanna elephant): 100669709
Entry
100669709         CDS       T04351                                 

Gene name
NCOR1
Definition
(RefSeq) LOW QUALITY PROTEIN: nuclear receptor corepressor 1
  KO
K04650  nuclear receptor co-repressor 1
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav01522  Endocrine resistance
lav04919  Thyroid hormone signaling pathway
lav05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    100669709 (NCOR1)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    100669709 (NCOR1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100669709 (NCOR1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:lav01009]
    100669709 (NCOR1)
Protein phosphatases and associated proteins [BR:lav01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100669709 (NCOR1)
SSDB
Motif
Pfam: GPS2_interact Myb_DNA-binding Myb_DNA-bind_6 DUF3915
Other DBs
NCBI-GeneID: 100669709
NCBI-ProteinID: XP_010598446
LinkDB
Position
Unknown
AA seq 2453 aa
MSSSGYPPNQGAFSTEQSRYPPHSVQYTFPSTRHQQEFAVPDYRSSHLEVGQASQLLQQQ
QQLRRRPSLLSEFHPGSERPQERRTGYEQFHPGPSQVDHDSLESKRPRLEQVSDAHFQRV
STAVLPLVHTLPEGLRSSADAKKDPAFGGKHEAPSSPLSGQPCGDDQNASPSKLSKEELI
QSMDRVDREIAKVEQQILKLKKKQQQLEEEAAKPPEPEKPVSPPPVEQKHRSIVQIIYDE
NRKKAEEAHKIFEGLGPKVELPLYNQPSDTKVYHENIKTNQVMRKKLILFFKRRNHARKQ
REQKICQRYDQLMEAWEKKVDRIENNPRRKAKESKTREYYEKQFPEIRKQREQQERFQRV
GQRGAGLSATIARSEHEISEIIDGLSEQENNEKQMRQLSVIPPMMFDAEQRRVKFINMNG
LMEDPMKVYKDRQFMNVWTDHEKEIFKDKFIQHPKNFGLIASYLERKSVSDCVLYYYLTK
KNAHYKALVRRNYGKRRGRNQQIARPSQEEKVEEKEEDKAEKTEKKEEEKKDEEEKDDKE
DSKENTKERDKTEGTAEEPEEREQATPRGRKTANSQGRRKGRITRSMTNEAAAASAAAAA
ATEEPPAPLPPPPEPISTEPVETSRWTEEEMEVAKKGLVEHGRNWAAIAKMVGTKSEAQC
KNFYFNYKRRHNLDNLLQQHKQKTSRKPREERDVSQCESVASTVSAQEDEDIEASNEEEN
PEDSEGAENSSDTESAPSPVEAVKPSEDSAENGTSRGNTEPVAEPQSNSETAPSTSPSPA
GPSVKHAENESTETQANDVNVETAEPMDVDHREHSAEVSSVLDLPAATKADSVDAEMRVP
GNGAAQVEGDTKERALERASEKGEPGGEDLVVAQQVTAQRPEHQSDNDSSATCSADEDVD
GEPERQRMFPMDSKSSLLNPTGSILVSSPIKPNPLDLQQLQHRAAVIPPMVSCTPCNIPL
GTPVSGYALYQRHIKAMHESALLEEQRQRQEQMDLECRSSTSPCGTAKSPNRDWEVLQPA
AHQVITNLPEGVRLPTTRPTRPPPPLIPSSKTTVASEKPSFIMGGSISQGTPGTYLTSHN
QASYTQETAKPSVGSISLGLPRQQEPAKSATVPYIKQEEFSPRSQNSQPEGLLVRAQHEG
VVRGTTGAIQEGSITRGTPTSKISVEGIPSLRGSITQGTPALSQAGIPTEALVKGSISRM
PIEENSPEKGREEAASKGHVIYEGKSGHILSYDNIKNAREGTRSPRTAHEISLKRSYESV
EGNTKQGMSMRESPVSAPLEGLICRALPRGSPHPDLKDRTVLSGSIMQGTPRATAESFED
GLKYPKQIKRESPPIRAFEGAITKGKPYDGITTIKEMGRSIHEIPRQDILTQESRKTPEV
VQSTRPIIEGSISQGTPIKYDSNSGQSAIKHNVKSLITGPSKLARGMPPLESVPENIKVI
ERGKYEDVKAGEPVRSRHTSVVSSGPSVLRSTLHEAPKAQLSPGIYEDTSARRTPVSYPS
TMSRGSPMMSRTSDVTVSSSKSTSHERKSTLTPTQRESLAAKSPVPGVDPVVSHSPFDPH
HRGNGAGEVYRSHLPTHLDPAMPFHRALDPAAAAYLFQRQLSPTPGYPSQYQLYAMENTR
QTILNDYITSQQMQVNLRPDVARGLSPREQQLGLPYPATRGIIDLTNMPPTILVPHPGGT
STPPMDRITYIPGTQISFPPRPYNSASVSPGHTAHLAAAASAEREREREREKERERERER
ERERIAAVSSDLYLRSGSEQPGRPGSHGYVRSPSPSVRTQEAMLQQRPSVFQGTNGTSVI
TPLDPTAQLRIMPLPAGGPSISQGLPASRYNTAADALAALVDAAASAPQMDVSKTKESKH
EAARLEDTLRSRSATVSEQQQLEQKTLEVEKRSVQCLYTSSAFPSGKPQPHSSVVYSEAG
KDKGPPPKSRYEEELRTRGKTTITAANFIDVIITRQIASDKDARERGSQSSDSSSSLSSH
RYETPNDAIEVISPASSPAPPQEKLQAYQAEVVKTSPAETDPSRQYEGPLHHYRPQQESP
PPQQQLPSSSPAEGAGQVPRTHRLITLADHICQIITQIRLEIQAAAQPPQQPPASTFQNA
PSALVSAPVRAKTSNRYSPDSQSQSVHHQRPGSRLSPENLVDKSRGRPGKSPERSHVSSE
TYEPISPPQVPVVHEKQDSMLLLSQRGAESTEQRNDSRSPASISYLPSFFTKLENTSPMV
KSKKQEIFRKLNSSGGGDSDMAAAQPGTEIFNLPAVTASGSVTSRGHSFADPAGNLGLED
IIRKALMGSFDNKVDDHGIVMSQPVPGSANTAVVPSGETRREERDPSPNSGGGVCKPKLI
SKSNSRKSKSPIPGQGYLGTERPSSVSSVHSEGDYHRQTPGWAWEDRPSSTGSTQFPYNP
LTMRMLSSTPPTSIACAPPPVSQAASHQQNRIWEREPAPLLSAQYETLSDSDD
NT seq 7362 nt   +upstreamnt  +downstreamnt
atgtcaagttcaggttatcctcccaaccaaggagcattcagcacagaacaaagtcgttat
cctccccactccgtccagtacacctttcccagcactcgtcaccagcaggaatttgcggtc
cctgattatcgttcttctcaccttgaagtcggccaggcgtcgcagctgttacagcagcag
cagcagctgcgccgaagaccctccttgctttcggaattccacccaggttctgagaggcct
caagaaaggagaactggatatgaacagtttcacccaggcccatcccaggtggatcatgat
tcactggagtctaagcgcccacgtctggagcaggtttctgatgcccactttcagcgtgtc
agtacggctgtcttacctttagtgcacacgctgccagaagggttgaggtcttctgcagac
gctaagaaggatccagcatttggaggcaaacatgaagctccatcctctccactttctggg
cagccatgtggagatgaccaaaatgcttcaccttccaaactttcaaaggaagagctaata
cagagtatggatcgtgtagatcgagaaatcgcaaaagtagagcagcagatccttaaactg
aaaaagaagcaacaacagctcgaagaagaagcagctaaacctccggagcccgagaagcct
gtgtcccctcctccagtggagcagaagcaccgcagtattgtccaaattatttatgatgag
aatcggaaaaaagcagaagaagctcataaaatttttgaaggtcttggcccaaaagttgaa
ctgccactctataaccagccatcagataccaaggtgtaccatgagaacatcaagacaaac
caggtgatgaggaaaaaactcattttattttttaaaagaagaaatcatgcaagaaaacaa
agggaacaaaaaatctgccagcgttatgatcagctcatggaggcatgggagaaaaaagtg
gacagaatagaaaataatcctcggaggaaagctaaagagagcaaaacaagggagtactat
gaaaagcagtttccagaaattcgaaaacaaagagaacagcaagagagatttcaacgagtt
gggcagaggggagctggtctctcagccaccattgctaggagtgagcatgagatttctgaa
attatcgatgggctttctgagcaggagaataatgagaaacaaatgcggcagctctctgta
atcccacccatgatgtttgatgcagaacaaagacgagtcaagttcattaacatgaatggg
cttatggaggacccaatgaaggtctataaagataggcagtttatgaatgtttggactgac
catgagaaggagatctttaaggacaagtttatccagcatccaaaaaactttggtctaatt
gcatcctacttagaaaggaagagtgtttctgattgtgttttatattactacttgaccaag
aaaaatgcacattataaagctctagtaagaaggaattatggaaaacgcagaggaagaaat
cagcaaattgcccgaccctcacaagaagagaaagtagaagaaaaagaagaggataaagca
gaaaaaacagaaaaaaaggaagaggaaaagaaagatgaagaagaaaaagatgacaaggaa
gactctaaagaaaataccaaggaaagggacaagacagaaggtacagcagaagaacctgag
gagagggagcaggccactccgcgggggcgcaagactgccaacagccagggccgccgtaag
ggccggatcaccaggtccatgacaaacgaagctgcagctgccagcgccgcagctgccgcc
gccaccgaagagcctccagctcctctgccaccccccccagaacccatttctacagagccc
gtggagacctctcgatggacagaagaagaaatggaagttgctaaaaaaggtctagttgaa
catggtcgtaactgggcagcaattgccaaaatggtgggaacaaaaagtgaagctcagtgt
aaaaacttctattttaactacaaaaggcgacacaatcttgacaacctcttgcagcagcat
aaacagaaaacatcacgaaagcctcgtgaagagcgagatgtgtctcagtgtgagagtgta
gcttccactgtttctgctcaggaagatgaagatattgaagcttctaatgaagaagaaaat
ccagaagatagtgaaggtgctgaaaatagttctgatacagaaagtgctccttcaccggtt
gaagccgtcaagcccagtgaagatagcgcagaaaacggtacttctcgaggaaacaccgaa
cctgtggctgagccccaatccaactctgaaactgcaccaagtacatctccctcaccagca
ggcccaagtgtgaaacatgctgaaaacgaaagtacggagacccaggcaaatgacgtcaat
gttgaaacagcagaacccatggacgtagatcatcgggagcacagtgccgaagtgagttct
gtccttgatctcccagcagcaaccaaagctgactctgtagatgctgaaatgagggtaccg
ggaaacggtgcagctcaagttgaaggtgataccaaagaaagagccttggagagagccagc
gagaagggcgagcctggaggtgaagatctggttgtggctcagcaggtcactgcccagcgg
cctgagcaccagtcagacaacgattccagtgccacctgcagtgctgacgaagatgtggat
ggagagcctgagaggcagaggatgtttcctatggactcaaagtcttcattgttaaatccc
actggatctatactggtttcatccccaataaaaccaaatccattggacctgcagcagctt
caacatcgagctgctgttatcccaccaatggtttcctgcaccccatgtaatataccactt
ggaaccccagtgagtggctatgctctttaccagcgacacattaaagcaatgcatgagtcg
gctctcctcgaggagcagcggcagaggcaagagcagatggatttggagtgcagaagttct
accagtccatgtggcactgccaagagtcccaacagagactgggaagtgctccagcctgct
gcacatcaagtgataactaatcttcccgaaggggttcggcttccaacaactcggccaacc
aggccgccgcctcctctcatcccatcatccaaaaccacagtggcttcagaaaaaccgtcc
tttataatgggaggctccatctcacagggaacacctggcacatatttgacctctcacaac
caggcttcctacactcaagaaacagctaagccctcagtggggtctatatctcttgggcta
ccacggcaacaggaacctgccaaatcagctactgtgccctacatcaagcaagaagaattt
tctccccgaagccaaaactcacaaccagagggtctactggtcagggcccagcatgaaggt
gtggtcagaggtaccactggagccatccaagagggaagtataactcgaggtaccccgacc
agcaaaatatcagtggaaggtatcccctccctgcggggctccatcactcagggcacccca
gctctgtcccaggctggcataccaactgaggctttggtgaagggatccatttctagaatg
cctattgaagagaacagtcctgagaaaggcagagaggaagctgcatccaaaggccatgtt
atttatgaaggcaaaagtggacacatcttatcctacgataatattaagaatgccagagaa
gggactcggagtccaagaacagctcatgaaatcagtttaaagcgaagctatgaatctgtg
gaaggaaatacaaaacaagggatgtcgatgagggagtctcctgtgtcagcacctttagag
gggctgatatgccgagcgttgccccgggggagccctcatcctgacctcaaagataggact
gtgctgtctggttccatcatgcagggcacaccacgagcaacagctgaaagctttgaagat
ggccttaaatatcccaagcagattaagagggagagtcctcccatacgagcgtttgaaggc
gccattaccaaaggaaaaccatacgatggcattactaccatcaaagaaatggggcgttcc
attcatgagattccacggcaagatattctaactcaggaaagccgaaagactccagaagtg
gtccaaagcacaaggccgataattgagggttccatctcccagggtacaccgataaagtat
gacagcaactcaggtcaatccgccatcaaacacaatgtcaaatccttaatcacaggacct
agtaaactagcccgtggaatgcctccactggaaagtgtaccagagaacataaaagtgata
gaacggggaaagtacgaggacgtgaaggcaggcgagcccgtgcgttcccggcacacgtcg
gtggtaagctccggcccttccgttcttaggtcaacacttcacgaagctcccaaagcacag
ctgagcccagggatttatgaggataccagtgcccggaggacacctgtgagctatccaagc
accatgtccagaggctcacccatgatgagtagaacctctgatgttacagtttcttccagc
aagtctaccagtcatgaaagaaaatctacacttacccctacccagagggaaagcctagca
gccaagtctccagttcctggggtggatcctgtagtaagccacagccctttcgatccccat
cacaggggcaacggggcaggagaggtctatcggagccatcttcccacacacttggaccca
gcaatgccgtttcacagggctctggatcctgcagccgctgcttacctgtttcaaagacag
ctttcaccaaccccaggctacccaagtcagtatcagctttatgccatggagaacacaaga
cagacaatcctaaatgattacattacctcacagcagatgcaagttaacttgcgcccagat
gtagccagaggactctccccaagagagcagcaactgggtcttccatacccagcaacaaga
ggaatcattgacctgaccaatatgcctccaacaattttagtgcctcatccagggggaacg
agcactcctcccatggacagaatcacttatattcctggtacacagattagtttccctccc
aggccatacaattctgcttctgtgtctccaggacacacagcacaccttgcagcagctgca
agtgctgaacgagaacgtgaaagagagcgggagaaggaacgggaaagggagcgggaacga
gagcgagagcgaattgctgcagtttcttcagacctctaccttcggtcaggctcagaacag
cctggtaggcctggtagtcatgggtatgttcgttctccttccccctcggtaagaactcag
gaggccatgttgcagcagagacccagcgttttccagggaaccaacggaaccagtgtgatc
actcctctggatccaactgctcagttacggatcatgccgctgcctgctggaggtccttcg
ataagccaaggcctgccagcctcccgttacaacactgctgcggatgccttggctgctctt
gtggacgctgcagcttccgcaccccagatggatgtttccaaaacaaaagagagtaagcat
gaagctgcaaggttagaagacactttgagaagcaggtcagcaacagttagtgagcagcag
cagctagagcagaagaccctggaggtggagaagagatctgtccagtgtctgtatacttcc
tcagcctttcccagtggcaagccccagccgcactcttcggtagtttattctgaggctggg
aaagataaagggcctcctccaaaatccagatatgaggaagagctaaggacccgagggaag
actaccattactgcagcaaacttcatagacgtgatcatcacccggcagattgcctcggac
aaggacgcgagggaacgtggctctcaaagttcagactcttctagtagcttatcttctcac
cggtatgaaacacctaatgatgccattgaggtgataagtcctgccagttcacctgcacca
ccccaggagaagctgcaggcctatcaagcagaggtggttaagacaagtccagcagaaact
gatcccagcagacagtacgaaggaccattgcaccactaccgaccacagcaggaatcaccg
cctccccagcagcagctgccatcctcttcaccggcagagggcgcagggcaggtgcccagg
acccaccgactcatcaccctggctgaccacatctgccaaattatcacacagatcaggtta
gaaatccaggctgccgcacagcccccccagcagcctcccgcctccacattccaaaatgca
ccatccgctttggtgtctgcacctgtgagggctaagacatcaaatcgctacagcccagat
tctcagtcgcagtccgtccaccatcaaagaccaggctcaaggctctctccagaaaatctt
gtggacaaatccaggggaaggcctggaaaatccccagagaggagtcacgtctcttcagag
acctacgagcccatctccccaccccaggttccagttgtgcatgagaaacaggacagcatg
ctgctgttgtctcagcgaggagcagagtccacggagcagaggaatgattcccgctcgcca
gcaagtataagctacttgccgtcgttcttcaccaagcttgaaaacacttcacccatggtt
aaatcaaagaagcaggaaatttttcgtaagttgaactcctctggtggaggtgactctgat
atggcagctgctcagccaggaactgagatctttaatttgccagcagtcaccgcctcaggt
tcagtaacctctagaggtcattcttttgctgaccctgctggtaatctcggtctagaagac
attatcaggaaggctctcatgggcagctttgataacaaagtggatgatcacggaattgtc
atgtcccagcctgtgcctggtagtgctaacactgcagttgtacccagtggagagacacgc
agagaggaaagggacccatcaccaaattcaggaggaggagtctgcaaaccaaagctgatc
agcaagtcaaacagcaggaaatctaagtctcctatccctgggcaaggctacctgggaacc
gagcggccctcttcagtgtcctctgtgcattcagaaggggactaccatcggcaaacgccg
gggtgggcctgggaagacaggccctcttcaacaggctcaactcagtttccttataaccct
ctgacgatgagaatgctgagtagtacgccacccacgtcgattgcgtgtgctcctcctcct
gttagccaagcagctagtcaccaacagaacaggatctgggaacgagagcctgccccactg
ctctcagcacagtacgagacgctgtcggatagtgatgactga

DBGET integrated database retrieval system