KEGG   Loxodonta africana (African savanna elephant): 100669754
Entry
100669754         CDS       T04351                                 

Gene name
RCAN1
Definition
(RefSeq) calcipressin-1
  KO
K17901  calcipressin-1
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04919  Thyroid hormone signaling pathway
lav04921  Oxytocin signaling pathway
lav05167  Kaposi sarcoma-associated herpesvirus infection
Brite
KEGG Orthology (KO) [BR:lav00001]
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    100669754 (RCAN1)
   04919 Thyroid hormone signaling pathway
    100669754 (RCAN1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    100669754 (RCAN1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:lav04131]
    100669754 (RCAN1)
Membrane trafficking [BR:lav04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    100669754 (RCAN1)
SSDB
Motif
Pfam: Calcipressin
Other DBs
NCBI-GeneID: 100669754
NCBI-ProteinID: XP_003410338
UniProt: G3SQG0
LinkDB
Position
Unknown
AA seq 198 aa
MHFRTFNYSFSSLVACVANSDVFSESETRAKFESLFRTYDKDITFQYFKSFKRVRINFSS
PLSAADARLQLHKTEFLGKEMKLYFAQTLHIGSSHLAPPNPDKQFLISPPASPPVGWKQV
EDATPVINYDLLYAISKLGPGEKYELHAATDTTPSVVVHVCESDQEKEDEDEETERMKRP
KPKIIQTRRPEYTSIHLS
NT seq 597 nt   +upstreamnt  +downstreamnt
atgcacttcagaaccttcaactacagctttagctcgctcgttgcctgtgtggcaaacagc
gatgtcttcagcgaaagtgaaaccagggccaagtttgaatcgctctttaggacatatgac
aaagatatcacctttcagtattttaagagcttcaaacgggtcaggataaacttcagtagc
cctttatctgcagcagacgccagacttcagctgcataagactgaatttctgggaaaggaa
atgaaattgtattttgctcagactttacacataggaagttcacatctggctccgccaaat
cctgacaagcagtttctgatctctcctcctgcctctccacccgtgggttggaaacaagtg
gaagatgccactccggtcattaactacgatctcttatacgctatctccaagctggggcca
ggggagaagtacgagctgcacgcagccactgacaccacgcccagcgtggtggtccacgtg
tgtgagagtgaccaagagaaggaggatgaggatgaggagacagagaggatgaagagaccc
aagcccaaaataatccagaccaggaggccggagtacacctctatccacttaagctga

DBGET integrated database retrieval system