KEGG   Loxodonta africana (African savanna elephant): 100669796
Entry
100669796         CDS       T04351                                 

Gene name
SHH
Definition
(RefSeq) LOW QUALITY PROTEIN: sonic hedgehog protein
  KO
K11988  sonic hedgehog
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04340  Hedgehog signaling pathway
lav04360  Axon guidance
lav05200  Pathways in cancer
lav05205  Proteoglycans in cancer
lav05217  Basal cell carcinoma
lav05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    100669796 (SHH)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    100669796 (SHH)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100669796 (SHH)
   05205 Proteoglycans in cancer
    100669796 (SHH)
  09162 Cancer: specific types
   05226 Gastric cancer
    100669796 (SHH)
   05217 Basal cell carcinoma
    100669796 (SHH)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:lav01002]
    100669796 (SHH)
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:lav00536]
    100669796 (SHH)
Peptidases and inhibitors [BR:lav01002]
 Cysteine peptidases
  Family C46: hedgehog family
   100669796 (SHH)
Glycosaminoglycan binding proteins [BR:lav00536]
 Heparan sulfate / Heparin
  Morphogens
   100669796 (SHH)
SSDB
Motif
Pfam: HH_signal Peptidase_M15_3
Other DBs
NCBI-GeneID: 100669796
NCBI-ProteinID: XP_023395567
LinkDB
Position
Unknown
AA seq 269 aa
MDEMLLLARCLVVVLVSTLLMCSGLACGPGRGFGKRRHPKKLTPLAYKQFIPNVAEKTLG
ASGRYEGKISRNSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDKLNALAISVMNQW
PGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRSKYGMLARLAVEAGFDWVYYES
KAHIHCSVKAGRERKLLCQETKHRMRAAQPTPAWRKPHFSFFRVASAKKVCKMYVWXRLP
PSLMTKDISIPVKTCIGMYLKLLSLCCLV
NT seq 810 nt   +upstreamnt  +downstreamnt
atggacgagatgctgctgctggcgagatgtctggtggtggtcctggtctccacgctcttg
atgtgctcagggctggcgtgcggacccggcaggggatttgggaagaggagacaccccaaa
aagctgacccctttagcctacaaacagtttatccccaatgtggccgagaagaccctaggg
gccagtggaagatacgaagggaagatctcgagaaactccgagcgatttaaggaactcacc
cccaattacaaccctgacatcatatttaaggatgaagaaaacaccggagcggaccggctg
atgactcagaggtgtaaggacaaactgaacgccttagccatctcggttatgaaccagtgg
ccaggagtgaagctgcgcgtgaccgagggctgggacgaggacggtcatcactcggaggag
tcgctgcactacgagggccgcgcggtggacatcaccacgtcggaccgcgaccgcagcaag
tacggcatgctggcccgcctggccgtagaggccggcttcgactgggtctactacgagtcc
aaggcgcacatccactgctcggtgaaagcaggtagagaaaggaagctactttgtcaagaa
actaaacacaggatgagagctgcccagcccactccagcctggagaaaacctcacttttcc
tttttcagggtcgccagtgccaagaaagtgtgtaaaatgtatgtgtggtgacgactgcca
ccctctctcatgactaaggatatatctattcctgtcaaaacgtgtattggaatgtacttg
aaattgttgtctttgtgctgtcttgtttga

DBGET integrated database retrieval system