KEGG   Loxodonta africana (African savanna elephant): 100669799
Entry
100669799         CDS       T04351                                 

Gene name
BAK1
Definition
(RefSeq) bcl-2 homologous antagonist/killer
  KO
K14021  Bcl-2 homologous antagonist/killer
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav01524  Platinum drug resistance
lav04141  Protein processing in endoplasmic reticulum
lav04210  Apoptosis
lav04215  Apoptosis - multiple species
lav05022  Pathways of neurodegeneration - multiple diseases
lav05132  Salmonella infection
lav05160  Hepatitis C
lav05162  Measles
lav05163  Human cytomegalovirus infection
lav05164  Influenza A
lav05165  Human papillomavirus infection
lav05167  Kaposi sarcoma-associated herpesvirus infection
lav05168  Herpes simplex virus 1 infection
lav05169  Epstein-Barr virus infection
lav05170  Human immunodeficiency virus 1 infection
lav05200  Pathways in cancer
lav05202  Transcriptional misregulation in cancer
lav05203  Viral carcinogenesis
lav05206  MicroRNAs in cancer
lav05210  Colorectal cancer
lav05212  Pancreatic cancer
lav05213  Endometrial cancer
lav05214  Glioma
lav05216  Thyroid cancer
lav05217  Basal cell carcinoma
lav05218  Melanoma
lav05220  Chronic myeloid leukemia
lav05222  Small cell lung cancer
lav05223  Non-small cell lung cancer
lav05224  Breast cancer
lav05225  Hepatocellular carcinoma
lav05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100669799 (BAK1)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100669799 (BAK1)
   04215 Apoptosis - multiple species
    100669799 (BAK1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100669799 (BAK1)
   05202 Transcriptional misregulation in cancer
    100669799 (BAK1)
   05206 MicroRNAs in cancer
    100669799 (BAK1)
   05203 Viral carcinogenesis
    100669799 (BAK1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100669799 (BAK1)
   05212 Pancreatic cancer
    100669799 (BAK1)
   05225 Hepatocellular carcinoma
    100669799 (BAK1)
   05226 Gastric cancer
    100669799 (BAK1)
   05214 Glioma
    100669799 (BAK1)
   05216 Thyroid cancer
    100669799 (BAK1)
   05220 Chronic myeloid leukemia
    100669799 (BAK1)
   05217 Basal cell carcinoma
    100669799 (BAK1)
   05218 Melanoma
    100669799 (BAK1)
   05213 Endometrial cancer
    100669799 (BAK1)
   05224 Breast cancer
    100669799 (BAK1)
   05222 Small cell lung cancer
    100669799 (BAK1)
   05223 Non-small cell lung cancer
    100669799 (BAK1)
  09164 Neurodegenerative disease
   05022 Pathways of neurodegeneration - multiple diseases
    100669799 (BAK1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100669799 (BAK1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100669799 (BAK1)
   05160 Hepatitis C
    100669799 (BAK1)
   05164 Influenza A
    100669799 (BAK1)
   05162 Measles
    100669799 (BAK1)
   05168 Herpes simplex virus 1 infection
    100669799 (BAK1)
   05163 Human cytomegalovirus infection
    100669799 (BAK1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100669799 (BAK1)
   05169 Epstein-Barr virus infection
    100669799 (BAK1)
   05165 Human papillomavirus infection
    100669799 (BAK1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100669799 (BAK1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:lav03029]
    100669799 (BAK1)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:lav02000]
    100669799 (BAK1)
Mitochondrial biogenesis [BR:lav03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Fission and Fusion factors
    100669799 (BAK1)
Transporters [BR:lav02000]
 Other transporters
  Pores ion channels [TC:1]
   100669799 (BAK1)
SSDB
Motif
Pfam: Bcl-2 Bcl-2_3
Other DBs
NCBI-GeneID: 100669799
NCBI-ProteinID: XP_003421109
LinkDB
Position
Unknown
AA seq 212 aa
MASGQGPGPPGQDCGDSTPPSTSEVQVARDAEDVFRSYVFYRHQQEQEAEGAATPADPEM
VSLPLEPNSVMGQVGRQLAIIGDDINRRYDVEFQTMLQHLQPTPQNASQYFIKIASSLFE
SGINWGRVVALLGFGYRLALHVYQHGLTGFLGHVTSFVADFMLKHCIARWIAQRGGWVAA
LDLGNGPIRNVLIALAVVLLGQYVVRRFWDPR
NT seq 639 nt   +upstreamnt  +downstreamnt
atggcatctgggcaaggcccgggtcctcccgggcaggactgtggagactctactccaccc
tccacttctgaggtgcaggtagccagggacgcggaggatgttttccgcagttacgtcttt
taccgccatcagcaggagcaggaggccgaaggggcggccacacccgctgacccggagatg
gtctccttgcccctggagcctaacagtgtcatggggcaggtgggtcggcagcttgccatc
atcggggatgatatcaaccggcgctacgatgtggagttccagaccatgttgcagcacctg
cagccaacaccacagaacgcttcccagtacttcatcaagattgcctcgagcctgtttgag
agcggcatcaactggggccgcgtggtggctctcctaggctttggctatcgcctggccttg
cacgtctaccagcatggcctgactggcttcctgggccacgtgaccagcttcgtggcagat
ttcatgctgaagcactgcatcgcccggtggattgcacagaggggcggctgggttgcagcc
ctggacttaggcaatggtcccatccggaatgtgctgatagctctggctgtggttctgttg
ggccagtatgtggtacgaagattctgggatcccagatga

DBGET integrated database retrieval system