KEGG   Loxodonta africana (African savanna elephant): 100670009
Entry
100670009         CDS       T04351                                 

Gene name
MYL6B
Definition
(RefSeq) myosin light chain 6B
  KO
K12751  myosin light chain 6
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04270  Vascular smooth muscle contraction
lav04530  Tight junction
lav04921  Oxytocin signaling pathway
Brite
KEGG Orthology (KO) [BR:lav00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    100670009 (MYL6B)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    100670009 (MYL6B)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100670009 (MYL6B)
Cytoskeleton proteins [BR:lav04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     100670009 (MYL6B)
Exosome [BR:lav04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   100670009 (MYL6B)
  Exosomal proteins of bladder cancer cells
   100670009 (MYL6B)
SSDB
Motif
Pfam: EF-hand_7 EF-hand_1 EF-hand_6
Other DBs
NCBI-GeneID: 100670009
NCBI-ProteinID: XP_003405171
UniProt: G3T9T7
LinkDB
Position
Unknown
AA seq 208 aa
MPPKKDVPVKKPAGPSPPKPAAKPASEAPPAKAKAEPAASPAPEKPQEPPIDLSKVVIEF
NKDQLEEFKEAFELFDRVGDGKILYSQCGDVIRALGHNPTNAEVLRILGNPKSDELKSRR
VDFETFLPMLQTAAKKRDQGSSYQDYLEGLRVLDKEGNGKVMGAELRQVLTTLGEKLTEE
EVEAILAGHEDINGCINYEAFLKHILSV
NT seq 627 nt   +upstreamnt  +downstreamnt
atgcctcccaagaaggatgttcccgtgaagaaaccagcagggccttctcccccaaagcct
gctgccaagccagcatcagaggcccctccagccaaggccaaggctgagccagctgcctcc
ccggcccctgaaaaaccccaggagccccccatcgatctctccaaagtggtgatcgagttt
aacaaggaccagctggaggagttcaaggaggccttcgagctgtttgaccgagttggtgat
ggtaagatcctgtacagccagtgtggggacgtgataagggccctgggccacaaccccacc
aacgccgaggtgctcaggatcctgggaaaccccaaaagtgatgagctgaagtcccggcgt
gtagactttgagactttcctgcccatgctccagacagcggccaagaaacgggaccaaggc
tcttcttaccaggactatttggaggggcttcgggtgttggacaaggaggggaatggcaaa
gtcatgggagcagagctcagacaggtcctcaccaccctgggagagaagctgactgaggag
gaggtggaggctattctggcaggacacgaggacatcaatggctgcatcaactatgaggcc
ttcctgaagcacatcctaagcgtctga

KEGG   Loxodonta africana (African savanna elephant): 100670299
Entry
100670299         CDS       T04351                                 

Gene name
MYL6
Definition
(RefSeq) myosin light polypeptide 6 isoform X1
  KO
K12751  myosin light chain 6
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04270  Vascular smooth muscle contraction
lav04530  Tight junction
lav04921  Oxytocin signaling pathway
Brite
KEGG Orthology (KO) [BR:lav00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    100670299 (MYL6)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    100670299 (MYL6)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100670299 (MYL6)
Cytoskeleton proteins [BR:lav04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     100670299 (MYL6)
Exosome [BR:lav04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   100670299 (MYL6)
  Exosomal proteins of bladder cancer cells
   100670299 (MYL6)
SSDB
Motif
Pfam: EF-hand_1 EF-hand_6 EF-hand_7 EF-hand_8 EF-hand_5 EF-hand_9
Other DBs
NCBI-GeneID: 100670299
NCBI-ProteinID: XP_010596254
LinkDB
Position
Unknown
AA seq 151 aa
MCDFTEDQTAEFKEAFQLFDRTGDGKILYSQCGDVMRALGQNPTNAEVLKVLGNPKSDEM
NVKVLDFEHFLPMLQTVAKNKDQGTYEDYVEGLRVFDKEGNGTVMGAEIRHVLVTLGEKM
TEEEVEMLVAGHEDSNGCINYEELVRMVLNG
NT seq 456 nt   +upstreamnt  +downstreamnt
atgtgtgacttcactgaggaccagaccgcagagtttaaggaggccttccagctgtttgac
cgaacgggtgatggcaagatcctgtacagccagtgtggggacgtgatgagggccctgggc
cagaaccccaccaacgccgaggtgctcaaggtcctggggaaccccaaaagtgatgagatg
aatgtgaaggtgctggattttgagcacttcctgcccatgctgcagactgtggccaagaac
aaggaccagggcacatatgaagactatgtcgaaggccttcgggtgtttgacaaggaaggg
aatggcactgttatgggtgctgaaatccggcatgtccttgtcacactgggtgagaagatg
acagaagaagaagtagagatgctggtggcagggcatgaggacagcaatggttgtatcaac
tatgaagagctcgtccgtatggtgctgaatggctga

KEGG   Loxodonta africana (African savanna elephant): 100672436
Entry
100672436         CDS       T04351                                 

Gene name
MYL9
Definition
(RefSeq) myosin regulatory light polypeptide 9
  KO
K12755  myosin regulatory light chain 9
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04022  cGMP-PKG signaling pathway
lav04024  cAMP signaling pathway
lav04270  Vascular smooth muscle contraction
lav04360  Axon guidance
lav04510  Focal adhesion
lav04530  Tight junction
lav04670  Leukocyte transendothelial migration
lav04810  Regulation of actin cytoskeleton
lav04921  Oxytocin signaling pathway
lav05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    100672436 (MYL9)
   04022 cGMP-PKG signaling pathway
    100672436 (MYL9)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100672436 (MYL9)
   04530 Tight junction
    100672436 (MYL9)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100672436 (MYL9)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    100672436 (MYL9)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    100672436 (MYL9)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100672436 (MYL9)
  09158 Development and regeneration
   04360 Axon guidance
    100672436 (MYL9)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100672436 (MYL9)
Cytoskeleton proteins [BR:lav04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     100672436 (MYL9)
Exosome [BR:lav04147]
 Exosomal proteins
  Exosomal proteins of hepatic cells
   100672436 (MYL9)
SSDB
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_11 UPF0154 Syntaxin SPARC_Ca_bdg DUF3741
Other DBs
NCBI-GeneID: 100672436
NCBI-ProteinID: XP_003411740
UniProt: G3SLE9
LinkDB
Position
Unknown
AA seq 172 aa
MSSKRAKAKTTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLAS
MGKNPTDEYLEGMMSEAPGPINFTMFLTMFGEKLNGTDPEDVIRNAFACFDEDASGFIHE
DHLRELLTTMGDRFTDEEVDEMYREAPIDKKGNFNYVEFTRILKHGAKDKDD
NT seq 519 nt   +upstreamnt  +downstreamnt
atgtccagcaaacgggccaaggccaagaccaccaagaagcgaccgcagagggccacttcc
aatgtctttgcaatgtttgaccagtcccagatccaggagtttaaggaggccttcaacatg
atcgaccagaaccgcgacggcttcattgacaaggaggacctgcacgacatgctggcctcg
atggggaagaaccccacagatgagtacctggagggcatgatgagtgaggctcccgggccc
atcaacttcaccatgtttctcaccatgtttggggagaagctgaacggcacagaccctgag
gacgtgatccgcaacgccttcgcctgcttcgacgaggatgcctcaggtttcatccacgag
gaccacctacgggagctgcttaccaccatgggtgaccggttcacagatgaggaagtggat
gagatgtaccgtgaggcgcccatcgataaaaagggcaacttcaactatgtggagttcacc
cgcatcctcaaacacggcgccaaggacaaggatgactag

DBGET integrated database retrieval system