KEGG   Loxodonta africana (African savanna elephant): 100670067
Entry
100670067         CDS       T04351                                 

Gene name
PIK3R5
Definition
(RefSeq) phosphoinositide 3-kinase regulatory subunit 5 isoform X1
  KO
K21290  phosphoinositide-3-kinase regulatory subunit 5/6
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04022  cGMP-PKG signaling pathway
lav04062  Chemokine signaling pathway
lav04072  Phospholipase D signaling pathway
lav04151  PI3K-Akt signaling pathway
lav04261  Adrenergic signaling in cardiomyocytes
lav04371  Apelin signaling pathway
lav04611  Platelet activation
lav04725  Cholinergic synapse
lav04921  Oxytocin signaling pathway
lav05145  Toxoplasmosis
lav05167  Kaposi sarcoma-associated herpesvirus infection
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    100670067 (PIK3R5)
   04072 Phospholipase D signaling pathway
    100670067 (PIK3R5)
   04022 cGMP-PKG signaling pathway
    100670067 (PIK3R5)
   04151 PI3K-Akt signaling pathway
    100670067 (PIK3R5)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100670067 (PIK3R5)
   04062 Chemokine signaling pathway
    100670067 (PIK3R5)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    100670067 (PIK3R5)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100670067 (PIK3R5)
  09156 Nervous system
   04725 Cholinergic synapse
    100670067 (PIK3R5)
 09160 Human Diseases
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    100670067 (PIK3R5)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100670067 (PIK3R5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:lav04131]
    100670067 (PIK3R5)
Membrane trafficking [BR:lav04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    100670067 (PIK3R5)
SSDB
Motif
Pfam: PI3K_1B_p101
Other DBs
NCBI-GeneID: 100670067
NCBI-ProteinID: XP_023412218
LinkDB
Position
Unknown
AA seq 878 aa
MQPGATTCTEDRIQHALERCLHGLSLSRRSTSWSAGLCLNCWSLQELVSRDPGHFLILLE
QILKKTREVQEKGTYDLLAPLALLFYSTVLCTPHFPPDSDLLRKAASTYHRFLTWPDPYC
SICQELLTFIDAELKAPGISYQRLVRAEQGLPTRSQRSSTVTVLLLNPVEVQAEFLAVAD
KLSSPGHSPHSAYITLLLHAFQATFGAHCDLPGLHCRLQSKTLAELEDIFMETAEAQELA
SGIRDAAEARQWLRTKLQAVGEKAGFPGVLDTANPGKLHTIPIPVARCHTYSWSQDSFDI
LQEILLKEQELLQPGVLRDNEGEEEEEDEEDLDTDGHCAQRDSLLSTSSEASGDSALSLA
SSQASGPALSSQLLTSFVSCLSDGMDSGYVEDSEESSPEWPRKPSRQERQGHRRPGQKFN
RIYKLFKSTGQLVLRRDSRTLEGSADLGLPLRRAESLCSPLDGLGLLPARAQRSLSLPPA
KLSAQLPSWLLAPASRRQPRRPFLSGDEDPKASTLRVVVFGSDRISGKVARAYSNLRRLE
NNRPLLTRFFKLQFFYVPVKRGQGTGSSACPVSPSQTPPVPTDSPRHPSPAQLDSVPWEE
STNDISHYLGMLDPWYERNVLGLMHLPPEVLCQQSLKPESRPLAGSAAPLPILADMLLYY
CRFAARPVLLQVYQTELTFSTGEKTTEIFIQSLELGHSAATRAIKASGPGSKRLGIDGER
EAVPLTLHIIYSKGAISGRSRWNNMEKVCTSVNLSKACRKQEELDSNMEALTLTLTEVVK
RQNPKSKKGFNQITTSQVKVDKVQIIGSNSCPFVVCLDQDERKILQSVVRCEISPCYKPE
KSSLRPPPQRATYPLAQASPDLCSLLCLPIMTFSGALP
NT seq 2637 nt   +upstreamnt  +downstreamnt
atgcagccaggggccacgacgtgcacggaggaccgtatccaacacgccctggagcgctgt
ttgcacgggctcagcctcagccgccgctccacctcctggtcagctgggctgtgtctgaac
tgctggagcctacaggagctggtcagcagggacccaggtcacttccttatcctccttgag
cagatcctgaagaaaactagagaggtccaagagaagggcacctatgacctcctcgccccc
ctggccctgctcttctactctactgtcctctgcacgccacacttcccgcctgactcagat
ctccttcggaaggcagccagcacctaccaccggttcctgacctggcctgatccctactgt
agcatctgccaggaactgctcaccttcattgatgctgaactcaaggccccaggaatctcc
taccagaggctagtgagggctgagcagggcctgcccactaggagtcaacgcagctccact
gtcaccgtgctattgctgaacccagtggaggtgcaggctgagttccttgctgtggccgac
aagctgagctcacccggacactcgccccatagtgcctacatcactctgctgctgcacgcc
ttccaggccacctttggggcccactgtgacctcccaggcctccactgcaggctgcagtcc
aagaccctggcagagcttgaggacatcttcatggagaccgcagaggcacaggagctggca
tctggcatcagggatgcagctgaggcccggcagtggctcaggaccaagctgcaagcggtg
ggagaaaaagccggcttccctggcgtcttagacactgcgaaccctggcaagctccacacc
attcccatccctgtggccaggtgccacacctacagctggagccaggacagcttcgacatc
ctgcaggaaatcctgctgaaggaacaggagctgctccagccgggggtcctgagggacaat
gaaggggaggaagaagaggaggacgaggaggacttggacaccgatgggcactgtgcccag
agggactctctgctctccaccagctcagaggcctcaggcgactctgccctgtcgctggcc
tcctcccaggcctcagggcctgccctctccagccagttgctgacctccttcgtctcctgc
ctctccgatggcatggacagcgggtatgtggaggacagcgaggagagctcccccgagtgg
ccccggaagcccagcagacaggagcgccagggccaccgcaggcccgggcagaagttcaac
aggatctataaactcttcaagagcaccggccagctggtgctgcggcgggactcgcggacc
ctggagggcagcgcggacttgggcctcccactacggcgggctgagagcctctgcagcccc
ctagacggcctgggcctgctccctgcccgagcccagcgctccctctctttgcccccggcc
aagcttagcgcccagctgcccagctggctcctggcccccgcctcacgccgccagccccgc
cgacccttcctcagcggggacgaggaccccaaggcctccaccctccgtgtcgtggtcttc
ggctcagatcggatttcgggcaaggtggcacgggcatatagcaatctgcggcggctggag
aacaatcgccctctcctcacccggttcttcaagctgcagttcttctatgtgcctgtaaag
aggggccaggggactggatccagtgcctgcccagtgtctccgagccagacacccccagtc
cctacggactcaccaaggcaccccagccctgcacagctggactcagtcccctgggaggag
agcaccaatgacatctcccactaccttggcatgctagacccctggtacgaacgcaacgtg
ctgggcctcatgcacctgccccctgaagtcctatgccagcagtctctgaagccggaatcg
cggcccctggcgggatctgccgccccgctgcccatcctggccgacatgctgctctactac
tgtcgcttcgccgcgcggccagtgctgctgcaggtctaccagacggagctgaccttcagc
acaggggagaagaccacggagatcttcatccagtccctggagctgggtcactctgctgcc
acccgggccatcaaggcttcaggtcctggcagcaagcggctgggtattgatggcgaacgg
gaggccgtccctctaacactacacattatctacagcaagggggccatcagtggacggagt
cgctggaacaatatggagaaggtctgtacctctgtcaacctcagcaaggcctgccggaag
caggaagagctagactccaacatggaggccctgacgctaaccctgacagaggtggtaaag
aggcaaaaccccaaatccaagaagggcttcaaccagatcaccacgtcgcaggtcaaagtg
gataaggttcagatcatcggctccaacagctgccccttcgtggtgtgtctggaccaggat
gagaggaagatcctacaaagtgtggtcaggtgtgagatctcaccctgctacaaaccagag
aagagcagcctccgcccaccaccccagagggccacctacccgctggcccaggcctcacct
gacctctgctccctcctctgcctgcccatcatgactttcagcggagctctgccctag

KEGG   Loxodonta africana (African savanna elephant): 100673566
Entry
100673566         CDS       T04351                                 

Gene name
PIK3CG
Definition
(RefSeq) phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform
  KO
K21289  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit gamma [EC:2.7.1.153]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav00562  Inositol phosphate metabolism
lav01100  Metabolic pathways
lav04022  cGMP-PKG signaling pathway
lav04062  Chemokine signaling pathway
lav04072  Phospholipase D signaling pathway
lav04151  PI3K-Akt signaling pathway
lav04261  Adrenergic signaling in cardiomyocytes
lav04371  Apelin signaling pathway
lav04611  Platelet activation
lav04725  Cholinergic synapse
lav04921  Oxytocin signaling pathway
lav05132  Salmonella infection
lav05145  Toxoplasmosis
lav05167  Kaposi sarcoma-associated herpesvirus infection
Brite
KEGG Orthology (KO) [BR:lav00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100673566 (PIK3CG)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    100673566 (PIK3CG)
   04072 Phospholipase D signaling pathway
    100673566 (PIK3CG)
   04022 cGMP-PKG signaling pathway
    100673566 (PIK3CG)
   04151 PI3K-Akt signaling pathway
    100673566 (PIK3CG)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100673566 (PIK3CG)
   04062 Chemokine signaling pathway
    100673566 (PIK3CG)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    100673566 (PIK3CG)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100673566 (PIK3CG)
  09156 Nervous system
   04725 Cholinergic synapse
    100673566 (PIK3CG)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100673566 (PIK3CG)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    100673566 (PIK3CG)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100673566 (PIK3CG)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:lav04131]
    100673566 (PIK3CG)
Enzymes [BR:lav01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     100673566 (PIK3CG)
Membrane trafficking [BR:lav04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    100673566 (PIK3CG)
SSDB
Motif
Pfam: PI3Ka PI3_PI4_kinase PI3K_rbd PI3K_C2 DUF4135 DUF3244 Myc-LZ
Other DBs
NCBI-GeneID: 100673566
NCBI-ProteinID: XP_003407251
LinkDB
Position
Unknown
AA seq 1102 aa
MDLENAEPPVVLRADNFRRRRRMKPRSAAASLSSMELIPIEFVLPTSQRNSKTRETVLLH
VAGHGNVEQVKAQVWLRALETSVAADFYHRFGPDHFLLLYQKKGQWYEIYDRHQVVQTLD
CLRYWKMLHRSPGQIHVVQRKALSVETVAFQQQLTALIGYDVTDVSNVHDDELEFTRRRL
VTPRMAEVAGRDPKLYAMHPWVTSKPLPEYLSKKIANNCIYIVIHRSTTSQTIKVSADDT
PGTILQSFFTKMAKKKSLMDIPESQSEQDFVLRVCGRDEYLVGETPIKNFQWVRHCLKNG
EEIHLVLDTPPDPALDEVRKEEWPLVDDCTGVTGYHEQLTIHGKDHESVFTVSLWDCDRK
FRVKIRGIDIPVLPRNADLTVFVEANIQHGQQVLSHRRTSPKPFTEEVLWNVWLEFGIKI
KDLPRGALLNLQIYCGKAPALSGKASAETPGSEPKGKAQLLYYVNLLLIDHRFLLRHGEY
VLHMWQISGKGEDQGSFSADKLTSATNPDKESSMSISILLDNYCHPIALPKHRPTPDPEG
DRVRAEMPNQLRKQLEAIIATDPLNPLTAEDKELLWHFRYESLKYPKAYPKLFSSVKWGQ
QEIVAKTYQLLARREIWDQSALDVGLTMQLLDCNFSDENVRAIAVQKLESLEDDDVLHYL
LQLVQAVKFEPYHDSALARFLLKRGLRNKRIGHFLFWFLRSEIAQSRHYQQRFAVILEAY
LRGCGTAMLHDFTQQVQVIEMLQRVTIDIKSVSVEKYDVSSQVISQLKQKLEDLQNSNLP
KSFRVPYDPGLKAGALVIEKCKVMASKKKPLWLEFKCADPTALSKETIGIIFKHGDDLRQ
DMLILQILRIMESIWETESLDLCLLPYGCISTGDKIGMIEIVKDATTIAKIQQSTVGNTG
AFKDEVLNHWLKEKCPLEEKFQAAVERFVYSCAGYCVATFVLGIGDRHNDNIMITETGNL
FHIDFGHILGNYKSFLGISKERVPFVLTPDFLFVMGTSGRKTSPHFQKFQDVCARAYLAL
RHHTNLLIILFSMMLMTGMPQLTSKEDIEYIRDALTVGKNEEDAKKYFLDQIEVCRDKGW
TVQFNWFLHLVLGIKQGEKHSA
NT seq 3309 nt   +upstreamnt  +downstreamnt
atggatctggaaaacgctgaaccacccgtggttctgagagcggacaacttccgtaggcgc
cggaggatgaagccgcgcagcgccgctgccagcctgtcctccatggaactcatccccatc
gagtttgtgctacccacgagccagcgcaacagcaagacccgggaaacggtgctactgcac
gtggctggccacggcaacgtggagcaggtgaaggcgcaagtgtggctgcgcgcgctggag
acgagcgtggcagcagacttctaccaccggttcggcccggaccacttccttctgctctac
cagaagaaggggcagtggtacgagatctacgacaggcaccaagtagtacagaccctggac
tgcctccgctactggaagatgctgcacaggagcccaggccagatccacgtggtgcagcgg
aaagcactttccgtggagactgtggccttccagcagcagctcacggcgctgattggctac
gacgtcactgacgtcagcaacgtgcacgacgacgagctcgagttcacgcgccgccgcttg
gtcaccccgcgcatggccgaggtggccggccgcgaccccaagctctatgccatgcacccc
tgggtgacatccaagcctcttcccgagtacttgtcgaagaagatcgccaacaactgcatc
tacattgtcattcaccgcagcaccaccagccagaccatcaaggtctcagccgatgacacc
ccaggcaccatcctccagagcttcttcaccaagatggccaagaagaagtctctgatggat
atccccgaaagccaaagtgagcaggattttgtgctacgcgtctgtggccgggatgaatat
ctggtgggtgaaacgcccataaaaaacttccagtgggtgaggcattgcctcaagaacgga
gaggagattcacctggtgctggacactcccccggacccagctctggacgaggtgaggaag
gaggagtggccactcgtggatgactgtaccggagtcactggctaccacgagcagctgacc
atccacgggaaggaccacgagagcgtgttcaccgtgtccctatgggactgtgaccggaag
ttccgggtgaagatccgaggcattgatatccctgtcctgccccggaacgctgacctcaca
gtttttgtggaggcaaacattcagcatgggcagcaagtcctttcccataggagaaccagc
cccaaacccttcacagaggaggtgctctggaatgtgtggcttgaatttggtatcaaaatc
aaagacttacccagaggggctttactgaacctccagatttattgcggcaaagccccagcc
ctgtctggtaaggcttccgcagagactcccggttccgagccaaaaggcaaagctcagctt
ctctactatgtgaacctgctgctgatagaccaccgattcctcctgcgccacggggagtac
gtgctgcacatgtggcagatatccggcaagggagaggatcaagggagtttcagtgctgac
aagctcacgtctgcgaccaacccagacaaggagagctcaatgtccatctccatccttctg
gacaattactgccatccaatagctttgcctaagcatcggcccacacctgaccctgaaggg
gaccgggttcgagctgaaatgcccaaccagcttcgtaagcaactagaggcaatcatagcc
accgatccacttaaccctctcacagcagaggacaaagaattgctctggcattttagatat
gaaagccttaagtatccaaaagcatatcctaagctgtttagctcagtgaaatgggggcaa
caagaaattgtggccaaaacataccagttgttagccagaagggagatctgggatcaaagt
gctttggatgttgggttaacgatgcaactcctggactgcaacttttcagatgaaaatgta
agagccattgcagttcagaaactggagagcttggaggatgatgatgttctgcattacctt
ttgcaactggtccaggctgtgaaatttgaaccataccatgacagtgcccttgccagattt
ctgctgaagcgtggtttaagaaacaaaagaattggtcatttcttattttggttcttgaga
agtgagatagcccagtccaggcactatcaacagagatttgctgtgatcctggaagcttat
ctgaggggctgtggcaccgccatgctgcatgactttacacaacaagtccaagtaatcgag
atgttacaaagagtcaccattgatattaagtcagtctctgttgaaaagtatgacgtcagt
tcccaagttatttcacaacttaagcaaaagcttgaagacctgcagaattctaatctccct
aaaagctttagagttccctatgaccctggactgaaagcaggagcactggtgattgaaaaa
tgtaaagtgatggcctccaagaaaaagcccctgtggctggagtttaaatgtgctgaccct
acagctctatcaaaggaaacaattggaatcatctttaaacatggtgatgatctgcgtcaa
gacatgctaattttacagattctacgaatcatggaatccatttgggagactgaatctttg
gacctgtgcctcctgccttatggttgcatttcaactggtgacaaaataggaatgatcgag
attgtgaaggatgccacgaccattgccaaaattcagcaaagcactgtgggcaacacaggt
gcatttaaagatgaagtcctgaatcactggctcaaagaaaagtgccctcttgaagaaaag
tttcaggcagcagtggaaagatttgtttattcctgtgctggctactgtgtggcaaccttt
gtccttggaataggagacaggcacaacgacaatattatgatcacagagacaggaaatctg
tttcatattgactttgggcacattcttgggaactacaaaagttttctgggcattagtaaa
gagagagtgccgtttgtgctaaccccagacttcctgtttgtgatgggaacttctggaagg
aagacaagcccacatttccagaaatttcaggatgtctgtgccagggcttatctagccctt
cgtcatcacacaaacctactgattatcctcttctccatgatgctgatgactggaatgccc
cagttaacaagcaaagaagatattgaatatattcgagatgccctaacagtggggaaaaat
gaggaggatgctaaaaagtattttcttgatcagattgaagtttgcagagacaaaggatgg
actgtgcagtttaactggttcctacatcttgttcttggtatcaaacaaggagagaaacat
tcagcctaa

KEGG   Loxodonta africana (African savanna elephant): 100674744
Entry
100674744         CDS       T04351                                 

Gene name
PIK3R6
Definition
(RefSeq) phosphoinositide 3-kinase regulatory subunit 6 isoform X1
  KO
K21290  phosphoinositide-3-kinase regulatory subunit 5/6
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04022  cGMP-PKG signaling pathway
lav04062  Chemokine signaling pathway
lav04072  Phospholipase D signaling pathway
lav04151  PI3K-Akt signaling pathway
lav04261  Adrenergic signaling in cardiomyocytes
lav04371  Apelin signaling pathway
lav04611  Platelet activation
lav04725  Cholinergic synapse
lav04921  Oxytocin signaling pathway
lav05145  Toxoplasmosis
lav05167  Kaposi sarcoma-associated herpesvirus infection
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    100674744 (PIK3R6)
   04072 Phospholipase D signaling pathway
    100674744 (PIK3R6)
   04022 cGMP-PKG signaling pathway
    100674744 (PIK3R6)
   04151 PI3K-Akt signaling pathway
    100674744 (PIK3R6)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100674744 (PIK3R6)
   04062 Chemokine signaling pathway
    100674744 (PIK3R6)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    100674744 (PIK3R6)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100674744 (PIK3R6)
  09156 Nervous system
   04725 Cholinergic synapse
    100674744 (PIK3R6)
 09160 Human Diseases
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    100674744 (PIK3R6)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100674744 (PIK3R6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:lav04131]
    100674744 (PIK3R6)
Membrane trafficking [BR:lav04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    100674744 (PIK3R6)
SSDB
Motif
Pfam: PI3K_1B_p101
Other DBs
NCBI-GeneID: 100674744
NCBI-ProteinID: XP_023412213
LinkDB
Position
Unknown
AA seq 889 aa
MGKGKEEEGTELVVLGFPLQIFRLQLRLKTPCGVPLRLLVPWGPRPPGAGLGEPWLRLSQ
EPPLYRKNNHLPSTLLPETTTSSLHSPQAPMESSDAELDLLRSVQAVLRELSVQAPALQS
NQGMWRWSLHKKVERDPWKSPALVRILLRELEKAEREDRRHVIIPLLHTLMYVLTKATGI
TEELYQRTYTFCTRLLTLPTPYCTVALDCAIRLKTETAVPGTLYQRMVIAEQNLINELYP
YQERVFLFVDPELVSASVCSALLLEIQAAQVQQTPEACMRHVVSHALQAALGEGCHSAAL
QKKLQASPRRALEQYFHAVVAAVEQMANEPSPSRAGHLERLEEIYCSLLGPPAAARGRCG
DEKTEEVNHLAQDHLASDPLQDRPPSIPLPSPHITFHLWTDEEQLWRELVLFLRPRSCLR
LSADLEALDLQGLLPDRELARVSVLSTDSGIERDLPSGADEPLVPSSPEMERAGLQRKGG
IKKRAWLPDLLLPGSCYGPPGLHQRTGGPGGDGELLPGVSRVHTARVLVLGDDRMLGRLA
QAYHTLRKRETQKFCLTPRLSLQLYYIPILAPEGPAASRQPELGELAAFLGRADRWYQST
VNTLCPAIHKLAEMPPSLDTSRTVDPFILDVITYYVRMGTQPIYFQIYTVKIFFSDLSRD
PTEDVFLTQLKVKIQDSKFPKEGFSPKKRGVVEGQGAELSICYQKALLSHRAREVTVSLR
ATGLVLKAIPANDTEGPTHFPRAAAPATDHTCLNVSVTEVVRSSNLAGRSFSSSSLHVEW
AREVTENGSLERKTRQILCPMGRASLEQPPQVGVGGLPGDCFPLGLGTLQRSRAVLWRVE
GGNTLLQATYAEQGVCLPVWLHRLIPWYKLKQVPWMQAWFEAWGCLATF
NT seq 2670 nt   +upstreamnt  +downstreamnt
atggggaaggggaaggaagaggaggggacagagctggtggtgctgggctttcctctgcag
atcttcagactgcagctgagactgaagacaccctgtggggttcctctcagacttctggtt
ccctggggcccgaggcctcctggggcaggacttggggaaccgtggctgcgactgagccaa
gaaccacctctgtacaggaagaacaaccacctgccctccactctgctgcccgagacaacc
acatcctccttacacagcccacaggctcccatggagagctcagatgcagagctggacctc
ttgaggagtgtgcaggccgtgctccgggaactcagcgtccaggcccctgctctgcagagc
aaccaaggcatgtggagatggtccctgcacaagaaggtggagcgagatccctggaagagc
ccagctctggtccgtatcctgctcagagagctggagaaggcagaacgcgaggaccgccgg
catgtcatcattcccctgctgcatacgctgatgtacgtgctcacgaaggccacaggcatc
actgaggagctctaccagagaacctacaccttttgcacgcggttactgaccctgcccacc
ccctattgcacagttgccttggactgcgctatccggctgaagacagagacagctgtccca
gggacgctgtaccaaaggatggtcattgctgaacagaacctgataaatgagctgtatccc
taccaggagagagtgttcctctttgtggaccctgagctggtctccgcctccgtgtgcagt
gccctattgctagagatccaggcggctcaggtgcagcagacaccagaggcctgcatgcgc
cacgtggtctcccacgccctgcaggctgccctgggggagggctgccactcagctgctctg
cagaagaagctgcaggccagccctcgccgcgccctggagcagtatttccacgctgtggtg
gccgccgtggagcaaatggctaacgagcccagtcccagccgggctggtcacctggagagg
ctggaggagatttactgctcgctcctggggcccccagcggccgcgaggggtcgctgcggc
gatgagaaaactgaggaggttaaccatcttgcccaagatcacctagccagtgaccctctc
caggaccggccaccaagcatccccctgcccagcccccacatcaccttccacctgtggacg
gatgaggagcagctctggagggagctcgtactcttccttcgccctcggtcctgcctccgc
ctcagtgctgacctggaggccttggatctgcagggcctcctgccagaccgggagctggcc
cgggtgtccgtgctgtccactgacagcggcatcgagcgggaccttccttcaggggccgat
gagccacttgtgcccagcagccctgagatggagcgagccgggctgcagcgcaaagggggc
atcaagaagcgggcatggctcccggacctcttgctgcctggcagctgttatggacccccc
gggctgcaccagaggacgggtgggcctggtggggacggggagctgctgcctggggtctcc
cgagtgcacacagcccgagtgctggtgctgggagacgacaggatgctggggcgcctagcc
caggcctaccacaccctcaggaaacgggagacccagaagttctgcctcactcccaggctc
agcctgcagctctactacatccccatcctggccccagaggggcctgcagcatccaggcag
cccgagcttggagagctggccgcattcctgggccgcgcggaccggtggtaccagagcacg
gtcaacacgctgtgcccggccatccacaagctggctgagatgcctccctccctggataca
tcccggactgtggaccctttcatcctagatgtcattacctactatgttcgcatgggcacc
caacccatctatttccagatctacacagtcaagatcttcttcagcgatctgagccgggac
cccaccgaggacgttttcctcacacagctaaaggtgaagatccaagactccaaattcccc
aaagagggtttttcacccaagaagagaggtgtggttgagggccaaggggctgagctctcc
atctgctaccaaaaggccctgctcagccaccgtgcacgagaggtcactgtttccctgcgg
gccactgggctggtcctgaaggccattccagccaatgacactgaagggcccacccacttc
cctcgagctgctgctcccgctacagaccacacgtgcctgaatgtcagtgtgacagaagtt
gtcagatcctccaacttagcgggaaggtccttctcgagcagcagtctgcatgtggaatgg
gccagagaggtgaccgagaatggcagcctggaacgcaagacccgccagatcctctgccca
atgggaagggcctctctggagcagcccccacaggttggggttggagggctgcctggagac
tgctttcctttgggcctgggtactttgcagagaagccgagcagtgctctggagagtggaa
ggtgggaacaccttgctccaggccacctatgcagagcaaggagtctgtctacctgtgtgg
ctccacagactaatcccatggtataagctgaagcaagtgccctggatgcaggcctggttt
gaggcatggggatgcttagctactttctag

DBGET integrated database retrieval system