KEGG   Loxodonta africana (African savanna elephant): 100670112
Entry
100670112         CDS       T04351                                 

Gene name
ABCB11
Definition
(RefSeq) LOW QUALITY PROTEIN: bile salt export pump
  KO
K05664  ATP-binding cassette, subfamily B (MDR/TAP), member 11
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav01522  Endocrine resistance
lav02010  ABC transporters
lav04976  Bile secretion
lav04979  Cholesterol metabolism
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    100670112 (ABCB11)
 09150 Organismal Systems
  09154 Digestive system
   04976 Bile secretion
    100670112 (ABCB11)
   04979 Cholesterol metabolism
    100670112 (ABCB11)
 09160 Human Diseases
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100670112 (ABCB11)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:lav02000]
    100670112 (ABCB11)
   04147 Exosome [BR:lav04147]
    100670112 (ABCB11)
Transporters [BR:lav02000]
 ABC transporters, eukaryotic type
  ABCB (MDR/TAP) subfamily
   ABCB11 subgroup
    100670112 (ABCB11)
Exosome [BR:lav04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100670112 (ABCB11)
SSDB
Motif
Pfam: ABC_membrane ABC_tran SMC_N AAA_16 RsgA_GTPase Zeta_toxin AAA_15 AAA_22 AAA_29 AAA_30 AAA_21 Rad17 SRP54
Other DBs
NCBI-GeneID: 100670112
NCBI-ProteinID: XP_010601153
LinkDB
Position
Unknown
AA seq 1325 aa
MSDSVILHSVKKFGEENHGFESDGSCNNDKKSRLQDEKKSGNVRVGFFQLFRFSSSTDIW
LMFVGSLCALLHGVAQPVLLLVFGTMTDVFIDYDTEIQELQTPGKECVNNTIVWINSSLN
QNVTNGTSCGLLDIESEMTTFAIYYAGIGIAAFVAGYIQICFWVIAAARQVQKMRKYYFR
RVMRMEIGWFDCNSVGELNTRFSEDINKINDALGDQITLFIKYMTTCVCGFLMGFYRGWK
LTLVIISVSPLIGIGAALIGLSVSKFTDFELKAYAKAGCVADEVISSMRTVAAFGGEKRE
VERYEKNLVFAQQWGIRKGIVMGLFTGYFWCLIFLCYALAFWYGSQLVLDEGEYTAGTLV
QIFLSVLIAALNLGHASTCLEAFATGRAAATSIFETIDQQPVIDCMSEDGYKLDRIKGEI
EFHNVTFHYPSRPDVKILSNLSMVIKPGEMTALVGSSGAGKSTALQLIQRFYDPSEGMVT
LDGHDIRSLNIKWLRAQIGIVEQEPALFSTTIAENIRYGKEDVTMEDIVRAAKEANAYNF
IMALPQKFDTLVGEGGSQMSGGQKQRIAIARALIRNPKILLLDMATSALDNESEAMVQEA
LSKIQHGHTIISVAHRLSTVRAADVIVGFEHGMAVERGTHKELLEKKGVYFTLMTLQSQG
NQVLHERVMQGKGATEDALLERRETFSRGSYRDSLRASIRQRSKSQLSQLVHEPPLTVLD
HKSTYEEDRKGADILVEEEVEPAPVRRILKFNAPEWPYMLVGSVGAAVNGTVTPFYAFLF
SEILGTFSIPDKEKQRAQINGVCLLFVAVGVVSFFTQFLQGYTFAKSGELLTKRLRKFGF
KAMLGQDIGWFDDLRNSPGALTTRLATDASQVQGAAGPQIGMIVNSFTNITVAMIIAFLF
SWKLSLVITCFFPFLALSGAIQTKILMGFATQDKQALETAGQITNEALSNIRTIAGIGNE
RRFIEAYEAALEKPFKTAIRKANIYGFCFAFSQCIAFIANSASYRYGGYLIXYEGLHFSY
VFRVISAVVLSGMALGRASSYTPSYAKAKISAARFFQLLDRKPPISVYSDAGEKWDNFQG
KIDFVDCTFTYPSRPDVQVLNGLSVSVSPGQTLAFVGSSGCGKSTSIQLLERFYDPDNGK
VMIDGHDTKKVNIQFLRSNIGIVSQEPVLFACSIADNIRYGDNTKEIPMERVIEAAKQAQ
LHAFVMSLPEKYETNVGAQGSQLSRGEKQRIAIARAILRDPKILLLDEATSALDTESEKT
VQVALDKAREGRTCIVIAHRLSTIQNSDIIAVMSQGVVIEKGTHEELMAQNGAYYNLVTT
GAAIS
NT seq 3978 nt   +upstreamnt  +downstreamnt
atgtctgactcagtaatcctccacagtgtgaagaaatttggagaggagaatcatggtttt
gagtcagatggatcatgtaacaatgataagaaatcaaggttacaagatgagaagaagagt
ggcaacgttcgagttggcttctttcaattgtttcggttttcttcatcgactgacatttgg
ctgatgtttgtgggaagtttatgtgcattactccatggagtggcccagccagtcctgcta
ctcgtttttggcacaatgacagatgtttttattgactatgacactgaaatacaagaactc
cagacccctgggaaagaatgtgtaaataacaccatagtatggatcaacagctccctgaac
cagaatgtgacaaatggaacaagttgtgggttgctggacattgaaagtgagatgaccaca
tttgccatttactatgctggaattggtattgcagcattcgtcgcaggatatattcaaata
tgcttttgggttattgctgcagctcgtcaggtacagaaaatgaggaaatattactttagg
agagtaatgagaatggaaatagggtggtttgactgcaattcagtgggagagctcaataca
agattctctgaagatattaataaaatcaacgatgcccttggtgaccaaataacccttttc
attaagtacatgaccacatgcgtctgtgggttcctgatgggattttacaggggttggaaa
ctgaccttggttattatttctgtcagccctctcattgggattggagcagccctcattggt
ctgagtgtgtccaagtttactgattttgagttgaaggcctatgccaaagcagggtgtgtg
gctgatgaagtgatttcatctatgcgaacagtggctgcttttggtggtgaaaaaagagag
gttgaaaggtatgagaaaaatcttgtgtttgcccagcaatggggaattagaaaagggatc
gtgatgggattatttactggatacttctggtgtcttatcttcctgtgttatgcactggcc
ttttggtatggctcccaacttgtcctggatgaaggagaatacacagcaggaactctagtc
cagattttcctcagcgtcttaatagcagctttaaatcttggccatgcatctacttgtttg
gaagcctttgcaactggacgtgcagctgccaccagtatttttgagacaatagaccagcaa
ccagtcattgactgcatgtcagaagatggttacaagttagatagaatcaagggtgaaatt
gaatttcataatgtgacattccactatccctccagaccagacgtgaagattttaagtaac
ctcagcatggtcattaaaccaggggaaatgacggctctggtaggatccagtggagctggg
aaaagtacagcactgcaactcattcagcgattctacgaccccagcgaaggcatggtgacc
ctggatggccatgacattcgctctcttaacattaagtggcttagagctcagattgggata
gtggagcaagagccagctctgttctccaccacaattgcagaaaatattcgctatggcaaa
gaagatgtgacgatggaggatatagtccgagctgccaaggaagccaatgcctacaacttc
attatggccctgccccagaaatttgacactcttgttggagaaggcggaagccagatgagt
ggtggccagaaacaaaggatagccattgctagagcccttatccgcaaccccaagatccta
cttttggacatggccacctcagcattggacaatgagagtgaagccatggtacaagaagca
ctgagcaagattcagcatggacataccattatctcagttgcccatcgcctatccacggtc
agagctgcagatgtcattgttgggtttgaacatggcatggcagtggaaagaggcacccac
aaagaactgctggaaaagaaaggagtttacttcactctaatgactttgcaaagtcaagga
aatcaagtccttcatgaaagggtcatgcagggaaaaggtgcaactgaagatgccttactt
gagagaagagagacctttagcagagggagttaccgtgatagtttaagagcttccatccgg
caacgctccaagtctcagctttctcagctggtacatgaacctccattaactgttctagat
cataagtctacttatgaagaagacagaaagggtgcagacattcttgtggaagaggaagtt
gaacctgccccagtcaggaggattctgaaattcaatgctccagagtggccctacatgctg
gtaggatctgtgggtgcagctgtcaatgggacagtcacacccttctatgcctttttattc
agcgaaattcttgggactttttcaattcctgataaagagaagcaaagggcacagatcaat
ggtgtgtgcctactctttgtagcagtgggcgttgtatcctttttcacgcaatttctgcag
ggatatacgtttgcaaaatctggtgaactcctcacaaaaaggctacgtaaatttggtttc
aaggcaatgttagggcaagacattggctggtttgatgacctcagaaatagccctggagca
ctgacgacaaggcttgccacagatgcttcccaagttcaaggggctgctggccctcagatt
gggatgattgtcaattccttcactaacatcactgtggccatgatcattgccttcttattc
agctggaagctaagcttggtcattacgtgcttcttccccttcttggctttatcaggagct
atacagaccaaaatattgatgggattcgccacacaagacaagcaagctctagagactgct
ggacagattacaaacgaagccctcagtaacatccgcactattgctggtattggaaatgag
aggcggtttattgaagcatatgaggctgcgctggagaagccattcaagacggccattcga
aaggcaaatatatatggattctgctttgccttttcccagtgcatagcatttattgctaat
tctgcttcctaccgatatggaggttacttaatcntatatgaaggactgcacttcagctat
gtgttcagggtgatcagtgcagttgtcctgagtgggatggctctcggaagagcctcctct
tatacaccaagctatgccaaagctaaaatatcagctgcacgtttttttcaactgctggac
cggaaacccccaatcagtgtatacagtgatgcaggtgaaaaatgggacaacttccagggg
aagattgactttgttgactgcacatttacgtatccttctcggcctgatgtacaagttctg
aacggtctgtcagtgtctgttagtccaggccagacactggcgtttgttgggagcagtgga
tgtggtaaaagcacaagtattcaactgttggaacgtttctatgatcctgacaacgggaag
gtgatgatagatggccatgacaccaaaaaggtaaatatccagttcctccgctcgaacatt
ggaattgtttcccaggaaccggtgctgtttgcctgtagcatagcagacaatatcagatat
ggggacaacaccaaagaaattcccatggaaagagtcatagaagccgcaaagcaggctcag
ctgcatgcctttgtcatgtccctcccagagaaatatgaaactaatgttggagctcaggga
tctcaactttctcgaggggagaaacaacgcattgctattgctcgggccatcctacgagat
cctaaaatcttgctactagatgaagccacttctgccttggacacagaaagtgaaaagacc
gtgcaagttgccctggacaaagccagagagggtcggacctgcattgtcattgcccatcgc
ttgtccaccatccagaactcggatatcattgctgtcatgtcgcagggggtagtgattgaa
aaggggacccatgaagaactgatggcccagaatggagcctactacaatctagtcaccaca
ggagccgccatcagttga

DBGET integrated database retrieval system