KEGG   Loxodonta africana (African savanna elephant): 100670137
Entry
100670137         CDS       T04351                                 

Gene name
EGF
Definition
(RefSeq) LOW QUALITY PROTEIN: pro-epidermal growth factor
  KO
K04357  epidermal growth factor
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav01521  EGFR tyrosine kinase inhibitor resistance
lav04010  MAPK signaling pathway
lav04012  ErbB signaling pathway
lav04014  Ras signaling pathway
lav04015  Rap1 signaling pathway
lav04020  Calcium signaling pathway
lav04066  HIF-1 signaling pathway
lav04068  FoxO signaling pathway
lav04072  Phospholipase D signaling pathway
lav04151  PI3K-Akt signaling pathway
lav04510  Focal adhesion
lav04540  Gap junction
lav04630  JAK-STAT signaling pathway
lav04810  Regulation of actin cytoskeleton
lav05160  Hepatitis C
lav05165  Human papillomavirus infection
lav05200  Pathways in cancer
lav05210  Colorectal cancer
lav05212  Pancreatic cancer
lav05213  Endometrial cancer
lav05214  Glioma
lav05215  Prostate cancer
lav05218  Melanoma
lav05219  Bladder cancer
lav05223  Non-small cell lung cancer
lav05224  Breast cancer
lav05226  Gastric cancer
lav05231  Choline metabolism in cancer
lav05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100670137 (EGF)
   04012 ErbB signaling pathway
    100670137 (EGF)
   04014 Ras signaling pathway
    100670137 (EGF)
   04015 Rap1 signaling pathway
    100670137 (EGF)
   04630 JAK-STAT signaling pathway
    100670137 (EGF)
   04066 HIF-1 signaling pathway
    100670137 (EGF)
   04068 FoxO signaling pathway
    100670137 (EGF)
   04020 Calcium signaling pathway
    100670137 (EGF)
   04072 Phospholipase D signaling pathway
    100670137 (EGF)
   04151 PI3K-Akt signaling pathway
    100670137 (EGF)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100670137 (EGF)
   04540 Gap junction
    100670137 (EGF)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100670137 (EGF)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100670137 (EGF)
   05231 Choline metabolism in cancer
    100670137 (EGF)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100670137 (EGF)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100670137 (EGF)
   05212 Pancreatic cancer
    100670137 (EGF)
   05226 Gastric cancer
    100670137 (EGF)
   05214 Glioma
    100670137 (EGF)
   05218 Melanoma
    100670137 (EGF)
   05219 Bladder cancer
    100670137 (EGF)
   05215 Prostate cancer
    100670137 (EGF)
   05213 Endometrial cancer
    100670137 (EGF)
   05224 Breast cancer
    100670137 (EGF)
   05223 Non-small cell lung cancer
    100670137 (EGF)
  09172 Infectious disease: viral
   05160 Hepatitis C
    100670137 (EGF)
   05165 Human papillomavirus infection
    100670137 (EGF)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100670137 (EGF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:lav04052]
    100670137 (EGF)
Cytokines and growth factors [BR:lav04052]
 Growth factors
  Growth factors (RTK binding)
   100670137 (EGF)
SSDB
Motif
Pfam: Ldl_recept_b FXa_inhibition cEGF DUF5050 EGF_CA EGF EGF_3 EGF_MSP1_1 hEGF
Other DBs
NCBI-GeneID: 100670137
NCBI-ProteinID: XP_023404279
LinkDB
Position
Unknown
AA seq 1218 aa
MKKGEKGAGEKESVKTHMSQAQSEMARVGEQLERVDHFSKGTKSSIFTVAIQIKLKLLTN
KGGIPDFKEGFTWISKFVKKNDLSMRTRITVGQQPSHDGPVPFLIFSHGNSIFRIDPEGT
NHKQLVADAGVSVFVDFHYSQERIYWVDLERQLLQRVFLNGTRQERVGNIEKRVSGMAIN
WINEEIIWSNQQEGVITVTDMKGNNSRVLLSSLNYPANVAVDPVERFVFWSSEVGSSLHR
ASLNGADAKILLETLEKITAMSLDVLNKRLFWIQYNKEGGYSYIGSCDYDGGSSQLHKHL
TRHNLFAISLFGDRIFYSTLKKKAIWIANKHTGKDMVKINLNQSLAPPGELKVVHPLVQP
KAKNDAGESDQKLCKLKKGICRGSVCGQDLRNHVCTCAEGYTLSRDGKYCEDVNECALWN
HGCTLGCENTPGSYYCTCPVGFILLPDGKRCHQLDSCPSNASECSHDCVLTSDGPVCFCP
EGSVLEADGKMCSGCSSSDNGGCSQLCLPLSPVSWECGCFPGYDLQLDKKSCAASGPQPF
LLFANSQDIRHMHFDGTDYEILVSQQMGMVFALDHDPVENKIYFANTALKWIERANLDGS
KRERLIGDAVDVPEGLAVDWINRKLYWTDRGKALIERSDLNGTQREIIINKHISQPRGIA
VHPMAKRLFWTDMGINPRIESSSLQGSDRRVIASSDLVQPSGITIDYLTDKLYWCDAKQS
VIEVANLDGSKRQRLAQNDVGHIFSVAVFEDHVWFSDWATPSVIRVNKRTGQNRVRLQGS
MLKPSSLVVVHPLAKPGADPCLYQNGGCEHICEGKFGTARCSCREGFMKAPDGKMCVTLN
GLQVSAGSEADLSNQVTPLDTLSTSQAFEDNVTEELQSQHTLVAEIMVSDQDDCAPVRCG
THAQCVSEGDNATCQCLKGFADDGKLCSDIDECEKNITVCPAASSQCINTEGGYVCRCLE
GYQEDGIHCLDTAPPSRLREDDLHAARHIYPGCPPSHDGYCLNDGLCMYIEQVDQYACKC
IVGFIGDRCQHRELRWWKLRHAGHGQQRNIAVVAVCVVGLVLLLLLALWGTRYYRNQKLL
SKNPKNPYEESSRDVSSSKPTDGEAGMSSPQLWFVILKEHQDLKCGSQPVALKDVQTADV
GSVQPTPYRQGPRVHGMNTEQSCWIPSSSNNTSGPQGMEKNLHLPSYVARPIAVGAEKLH
SLLSAKPLWQQRGPNPPC
NT seq 3657 nt   +upstreamnt  +downstreamnt
atgaagaagggagaaaaaggagctggagaaaaggaatctgtgaaaacgcacatgtcacag
gcccaaagtgaaatggccagagttggagaacaacttgaaagagtggatcatttctcaaag
ggaacaaaatcaagtatctttactgttgcaattcagatcaaactgaagcttctgaccaat
aaaggaggaatcccagatttcaaggaggggttcacctggatttctaaattcgtgaaaaag
aatgacctttccatgagaacaagaatcactgtaggccagcaaccttcacatgatggtcct
gtgcccttcttaattttctcccatggaaacagtatctttaggattgacccggaaggaact
aatcacaagcaattggtggcagatgctggagtatctgtgtttgtggattttcattacagc
caggaaagaatctattgggtggatttagaaagacaacttttgcaaagagtttttctgaat
gggacaaggcaagagagagtgggcaatatagagaaaagagtttcaggaatggcaataaat
tggataaatgaagaaattatttggtcaaaccaacaagaaggagtcattacagtaacagat
atgaaaggaaacaattctcgggttctcttaagtagcttaaattatcctgcaaacgtagca
gttgatccagtagaaaggtttgtattttggtcttcagaggtgggcagcagccttcacaga
gccagcctcaatggtgcggatgcgaagattctgctggagacactagagaaaataacagcc
atgtcattggatgtgcttaataaacggctcttttggattcagtacaataaagaaggaggc
tattcttatattggttcttgtgattatgatggaggttcttctcaacttcacaaacatctt
acacggcacaatttgtttgcaatatctctttttggtgaccgtatcttctattcaaccttg
aaaaagaaggcaatttggatagccaacaaacacactgggaaagatatggttaaaattaac
ctcaatcagtccttggcaccacctggtgaacttaaagtagtgcatccacttgtacagccc
aaggccaagaacgatgctggggagtctgatcagaaactttgcaaattgaagaaaggaatc
tgcagaggcagcgtgtgtgggcaagatctcaggaaccacgtgtgcacgtgtgcggaggga
tatactttaagcagagacgggaagtactgcgaagatgtcaatgaatgtgccctttggaat
catggctgtactcttggttgtgagaacacccctgggtcctattactgcacatgccctgta
ggatttattctgcttcctgatggaaaacgatgccaccaattagattcttgtccaagcaat
gcatctgagtgcagccatgactgtgttctgacatcagatggccccgtatgtttctgtcct
gaaggctcagtgcttgaggcagatggaaaaatgtgtagtggctgttcgtcatctgataat
ggtggttgtagccagctctgcctccccctcagcccagtatcctgggagtgtggttgcttt
cctgggtatgatctacagctggacaaaaaaagctgtgcagcttcaggaccacaaccgttt
ttactgtttgccaattctcaagatattcgacacatgcattttgatggaacagattatgaa
atcctggtcagtcagcagatgggaatggttttcgccctagaccatgaccctgtggaaaat
aagatatactttgccaacacagccctgaagtggatagagagagctaatttggatggttcc
aagcgggaaaggcttattggggatgcagtagatgtgccagaaggtcttgctgtagactgg
attaaccgtaaactctactggacagacagagggaaagctctcattgaaaggagtgactta
aatggaacacaacgtgaaataatcattaacaagcacatctctcagccccgaggaattgct
gttcatccgatggccaagagactattctggactgatatgggtattaatccacgaattgaa
agttcttcccttcaaggctctgaccgacgagttatagctagttctgatctggtccagccc
agtggaataacgattgactacttaactgacaagttgtattggtgtgatgccaagcaatca
gtgattgaagtggccaatctggatggttcaaaacgccaaagacttgcccagaatgatgta
ggtcacatattttcagtagccgtgtttgaggatcatgtgtggttctctgattgggctacg
ccatcagtaataagggtgaacaagaggacaggccaaaacagggtccgtctccaaggcagc
atgctgaagccctcatcgctggttgtggttcatccattggcaaaaccaggagcagatccc
tgtttataccaaaatggcggctgtgaacatatttgcgaagggaagtttggaacagctcgg
tgttcatgtcgtgaaggttttatgaaagccccagatgggaaaatgtgtgtgactctgaat
ggtcttcaggtatcagcaggtagtgaagcagatctaagtaatcaagtaacaccgctggac
accttatcgacaagtcaagcctttgaagataatgttacagaagaattgcaatctcagcac
acgctagtggctgaaatcatggtgtcagatcaagatgactgtgctcccgtgagatgtggc
acacatgctcaatgtgtttcagaaggagacaacgccacatgtcagtgtttgaaaggattt
gctgacgatggaaaattatgttctgatatagacgaatgtgagaagaacatcacagtttgc
cctgcagcctcatcccagtgcatcaatacggaaggtggctatgtctgcaggtgcttagaa
ggctaccaagaagatggaattcactgtctcgacacagccccaccctctcgtctcagggaa
gatgacctccatgctgccagacatatctaccctggatgtcccccgtcgcacgatggttac
tgcctcaatgatggtctgtgcatgtatattgaacaagtagaccagtacgcatgcaaatgt
atcgttggcttcatcggggatcgatgtcagcaccgagaattgagatggtggaaactgcgc
cacgctgggcatgggcagcaacggaacattgctgtggtggctgtctgcgtggttgggctt
gtcctgcttctcctcctggcactgtgggggactcgctattacaggaatcagaagttgcta
tcaaaaaatccaaagaatccatatgaagagtcgagcagagatgtgagcagtagcaagcct
actgatggagaggctggaatgtcttccccccaactttggtttgtgattttaaaggaacac
caagacctcaagtgtgggagtcaacctgtggccctgaaggatgttcagacagcagatgtt
gggtcagtgcaaccaactccatacaggcaggggcctcgggttcatggaatgaacacagag
caaagctgctggattccatcatcaagtaataatacctctggtccccagggaatggagaag
aaccttcatctaccgtcctatgtggcgcgacccattgctgtgggggctgagaagctccac
tctctcctgtcagctaagccattatggcaacaaaggggtcccaatccaccatgctag

DBGET integrated database retrieval system