KEGG   Loxodonta africana (African savanna elephant): 100670218
Entry
100670218         CDS       T04351                                 

Gene name
TYRP1
Definition
(RefSeq) 5,6-dihydroxyindole-2-carboxylic acid oxidase
  KO
K00506  tyrosinase-related protein 1 [EC:1.14.18.-]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav00350  Tyrosine metabolism
lav01100  Metabolic pathways
lav04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:lav00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    100670218 (TYRP1)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100670218 (TYRP1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lav04147]
    100670218 (TYRP1)
Enzymes [BR:lav01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.18  With another compound as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.18.-  
     100670218 (TYRP1)
Exosome [BR:lav04147]
 Exosomal proteins
  Exosomal proteins of melanoma cells
   100670218 (TYRP1)
SSDB
Motif
Pfam: Tyrosinase Laminin_EGF Comm
Other DBs
NCBI-GeneID: 100670218
NCBI-ProteinID: XP_003407396
UniProt: G3SPG1
LinkDB
Position
Unknown
AA seq 537 aa
MKPCKPLSLGYVFFPLLLLQQVCAQFPRECVTADALRSGMCCPDLSPVSGPGTDRCGSST
GRGRCEVVTADSRPHSPQYPHDGTDDREGWPTRFFNRTCHCNGNFSGHNCGTCRPGWRGT
ACDRRVLIVRRNLLDLSVEEKNRFVRALDMAKRTTHPQFVIATRRSEEILGPDGNTPQFE
NISIYNYFVWTHYYSVKKTFLGKGQESFGEVDFSHEGPAFLTWHRYHLLQLEKDMQEMLQ
DPSFSLPYWNFATGKNVCDICTDDLMGSRSNFDSTLISPNSVFSQWRIVCESLEDYDTLG
TLCNSTEGGPIRRNPAGNVARPMVQRLPEPQDVTQCLEVGLFDTPPFYSNSTNSFRNTVE
GYSDPTGKYDPAVRSLHNLAHLFLNGTGGQTHLSPNDPIFVLLHTFTDAVFDEWLRRYNA
DISSFPLENAPIGHNRQYNMVPFWPPVTSTEMFVTAPDNLGYAYEVQWPSRDFSISEIVT
IGVVASLVVVAVIFAGASCLIRARSHMDEANQPLLSDHYQHYTDDYEKIQNPNQSVV
NT seq 1614 nt   +upstreamnt  +downstreamnt
atgaaaccttgtaaacctctctctctgggttatgtcttctttcccctgctgcttcttcag
caggtctgtgctcagttcccaagagagtgtgtcactgctgacgctttgagaagtggcatg
tgttgcccagacctgtctcctgtgtctgggcctgggacagaccgctgtggctcgtcaacc
ggcaggggcaggtgtgaggtggtgactgcagactcccgaccccacagtccgcagtaccct
cacgatggcacagatgaccgggagggctggcccacacggttcttcaatagaacatgccac
tgcaatggcaatttctcaggacacaactgtgggacatgccgtcctgggtggagaggcact
gcttgtgaccgaagggttctcatagtcaggagaaatcttttggacttaagtgtagaagaa
aagaaccgttttgtccgagccctggatatggcaaagcgcacaactcatccccagtttgtc
attgccaccaggagatcagaagaaatactggggccagatggcaacacaccacaatttgag
aacatttccatctacaactactttgtttggacacactattactccgtcaaaaagactttc
cttgggaaagggcaggagagctttggtgaagtagatttctctcatgaaggaccagctttt
ctcacatggcacaggtaccatctactgcagctggagaaggacatgcaggaaatgttgcag
gatccttctttctcccttccttactggaattttgcaactggaaagaatgtctgtgatatc
tgcaccgatgacttgatgggatcgagaagcaactttgattccactcttataagtccgaac
tctgtcttttctcaatggagaatagtctgtgaatccctggaagattatgataccctggga
accctttgtaacagcactgaaggtgggcccattaggagaaatccagccggaaacgtggct
agaccaatggtgcaacgtcttcctgaaccacaggatgtcactcagtgcttggaagtcggt
ttatttgacacacctcctttttactccaattctacaaatagcttccgaaacacagtggaa
ggttatagtgatcccacaggaaagtatgatcctgccgttcgaagccttcacaatttggct
catctctttctgaatggaacagggggacaaacccatttatctccaaatgatcctattttt
gtcctcctgcatactttcacggatgcagtctttgatgaatggctgaggagatacaatgct
gatatatcctcatttccactggaaaatgcccctattggacataatagacaatataatatg
gtgccattctggccaccagtcaccagcacagagatgtttgttactgctccagacaacctg
ggatatgcttatgaagtacaatggcctagtcgggattttagtatttcggagattgttacc
ataggagtagttgcttctctagtagtggttgcggtcatttttgctggtgcgtcttgtctg
attcgtgccagaagccacatggatgaagcaaatcagcctctcctctctgatcactatcaa
cactatactgatgattatgaaaaaattcagaatcctaatcaatctgtggtctga

DBGET integrated database retrieval system