KEGG   Loxodonta africana (African savanna elephant): 100670232
Entry
100670232         CDS       T04351                                 

Gene name
CCK
Definition
(RefSeq) cholecystokinin
  KO
K05226  cholecystokinin
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04080  Neuroactive ligand-receptor interaction
lav04911  Insulin secretion
lav04972  Pancreatic secretion
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100670232 (CCK)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    100670232 (CCK)
  09154 Digestive system
   04972 Pancreatic secretion
    100670232 (CCK)
SSDB
Motif
Pfam: Gastrin
Other DBs
NCBI-GeneID: 100670232
NCBI-ProteinID: XP_003409766
UniProt: G3SZV7
LinkDB
Position
Unknown
AA seq 115 aa
MNNGVRLCVLMAVLAAGALVQPAPPADPAGPGVQRAEEAPRRPLRAVQRVDGEPRAHLGA
LLPRYIQQARKVPSGRMSIIKNLQGLDPSHRISDRDYMGWMDFGRRSAEEYEYPS
NT seq 348 nt   +upstreamnt  +downstreamnt
atgaataacggcgtgcgcctgtgcgtgctgatggctgtactggcggcgggcgccctggtg
cagcccgcgcccccggctgatcccgctggccccggggtgcagcgagcagaggaggcgccc
cggaggccgctgagggcagttcagagggtggacggcgagccccgagcgcacctgggagcg
ctgctgcccagatatatccagcaggcccggaaagttccttctggccggatgtctatcatt
aagaacctgcagggcctggaccccagccacaggataagcgaccgggactatatgggctgg
atggattttggccgccgtagtgccgaggagtatgagtacccctcctag

DBGET integrated database retrieval system