KEGG   Loxodonta africana (African savanna elephant): 100670373Help
Entry
100670373         CDS       T04351                                 

Definition
(RefSeq) anionic trypsin-like
  KO
K01312  trypsin [EC:3.4.21.4]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04080  Neuroactive ligand-receptor interaction
lav04972  Pancreatic secretion
lav04974  Protein digestion and absorption
lav05164  Influenza A
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100670373
 09150 Organismal Systems
  09154 Digestive system
   04972 Pancreatic secretion
    100670373
   04974 Protein digestion and absorption
    100670373
 09160 Human Diseases
  09167 Infectious diseases
   05164 Influenza A
    100670373
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:lav01002]
    100670373
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lav04147]
    100670373
Enzymes [BR:lav01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     100670373
Peptidases [BR:lav01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   100670373
Exosome [BR:lav04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100670373
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin DUF1986
Motif
Other DBs
NCBI-GeneID: 100670373
NCBI-ProteinID: XP_023394926
LinkDB All DBs
Position
Unknown
AA seq 258 aa AA seqDB search
MLGHRPGLCLPWPADPLSLPLCTQVSLPTKDDDDKIVGGYTCKENSVPYQASLNSGYHFC
GGSLINDQWVVSAAHCYKYRIQVRLGEYNIDVLEGNEQFISTAKTIRHPQYDSKTLDNDI
LLIKLSSSAVINSQVSPVALPSGCASAGTWCLISGWGNTLSSGVNYPELLQCLDAPLLSQ
ADCEASYPGEITENMVCAGFLEGGKDSCQGDSGGPVVCNGELQGIVSWGYGCAQENLPGV
YTKVCNYVNWIQDTIAAN
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgctcggacacaggcctgggctctgcctcccatggcctgctgaccccctctcccttcct
ctctgcacccaagtctctctccccacaaaagacgatgatgacaagattgtcgggggctac
acctgcaaggagaattctgtgccctaccaggcgtccctgaactctggctaccacttctgt
ggcgggtccctcatcaacgaccagtgggtggtatccgcagcccactgctacaagtaccgc
atccaagtgaggctgggtgagtacaacatcgacgtcctcgaggggaatgagcagttcatt
agcacagccaagaccatccgccaccctcagtatgacagcaagaccctggacaatgacatc
ttgctgatcaagctgtcctcaagtgcagtcatcaactcgcaggtgtcgccagtggccctg
ccctcaggctgtgcttctgctggcacctggtgcctcatctctggctggggcaacaccctc
agctctggggtgaactaccctgagctgctgcagtgcctggatgccccactgctgagccag
gccgattgcgaggcctcctaccccggggagatcactgagaacatggtctgcgccggcttt
ctggagggaggcaaggactcctgccagggtgactccggcggccccgtggtctgcaatgga
gagctgcagggcatcgtgtcctggggctatggctgtgcccaggagaacctgcctggtgtc
tacaccaaggtctgcaactacgtgaactggatccaggacaccattgctgccaactga

DBGET integrated database retrieval system