KEGG   Loxodonta africana (African savanna elephant): 100670387
Entry
100670387         CDS       T04351                                 

Gene name
BTK
Definition
(RefSeq) tyrosine-protein kinase BTK isoform X1
  KO
K07370  Bruton agammaglobulinemia tyrosine kinase [EC:2.7.10.2]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04064  NF-kappa B signaling pathway
lav04380  Osteoclast differentiation
lav04611  Platelet activation
lav04662  B cell receptor signaling pathway
lav04664  Fc epsilon RI signaling pathway
lav05169  Epstein-Barr virus infection
lav05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    100670387 (BTK)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100670387 (BTK)
   04662 B cell receptor signaling pathway
    100670387 (BTK)
   04664 Fc epsilon RI signaling pathway
    100670387 (BTK)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100670387 (BTK)
 09160 Human Diseases
  09163 Immune disease
   05340 Primary immunodeficiency
    100670387 (BTK)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    100670387 (BTK)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lav01001]
    100670387 (BTK)
Enzymes [BR:lav01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     100670387 (BTK)
Protein kinases [BR:lav01001]
 Non-receptor tyrosine kinases
  TEC family
   100670387 (BTK)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase SH2 SH3_1 PH BTK SH3_9 SH3_2 Kinase-like SH3_3 SH3_10 Pkinase_fungal Kdo APH SH3_4
Other DBs
NCBI-GeneID: 100670387
NCBI-ProteinID: XP_003422088
LinkDB
Position
Unknown
AA seq 659 aa
MASVILESIFLKRSQQKKKTSPLNFKKRLFLLTGQKLSYYEYDFERGRRGSKKGSIDVEK
ITCVETVVPEKNPPPERQIPRRGEESGEMEQISIIERFPYPFQVVYDEGPLYVFSPTEDL
RKRWIHQLKNVIRYNSDLVQKYHPCFWIDGQYLCCSQTAKNAMGCQILENRNGSLKPGSS
HRKTKKPLPPTPEEDQILKKPLPPEPTAAPVSTSELKKVVALYDYMPMNANDLQLRKGEE
YFILEQSNLPWWRARDKNGEEGYIPSNYVTEAEDSIEMYEWYSKHMTRSQAEQLLKQEGK
EGGFIVRDSSKAGKYTVSVFAKSTGDPQGVIRHYVVCSTPQSQYYLAEKHLFSTIPELIN
YHQHNSAGLISRLKYPVSQQNKNAPSTAGLGYGSWEIDPKDLTFLKELGTGQFGVVKYGK
WRGQYDVAIKMIKEGSMSEDEFIEEAKVMMNLSHEKLVQLYGVCTKQRPIFIITEYMANG
CLLNYLREMRHRFQTQQLLEMCKDVCEAMEYLESKQFLHRDLAARNCLVNDQGVVKVSDF
GLSRYVLDDEYTSSVGSKFPVRWSPPEVLMYSKFSSKSDIWAFGVLMWEIYSLGKMPYER
FTNSETAEHIAQGLRLYRPHLASERVYTIMYSCWHEKADERPTFKILLSNILDVMDEES
NT seq 1980 nt   +upstreamnt  +downstreamnt
atggcttcagtgatcctggagagcatctttctgaagcgatcccagcagaaaaagaaaaca
tcacctttaaacttcaagaagcgcctctttcttttgactggccagaaactttcctactat
gagtatgactttgaacgtgggagaagaggcagtaagaagggttcaatagatgttgagaag
atcacctgcgttgaaacagtggttcctgaaaaaaatcctccccctgaaagacagattccg
agaaggggtgaagagtccggcgaaatggagcagatttcaatcattgaaaggttcccttac
cccttccaggttgtgtatgatgaagggcctctctatgtcttctccccaactgaagacctg
aggaagcggtggattcaccagctgaaaaacgtaatccggtacaacagtgatctggtacag
aaataccacccttgcttctggattgatgggcagtatctctgctgctctcagacagccaaa
aacgccatgggctgccaaattttggagaacaggaatggaagcttaaaacctgggagctcc
caccggaagacaaaaaagcctcttcctcccactcccgaggaggaccagatcttgaaaaaa
ccactacctcctgagccaacagcagcccctgtctccacaagtgagctgaaaaaggttgta
gccctttatgattatatgccaatgaatgcaaatgatctacagctgcgcaagggtgaagag
tattttatcctggagcagagcaacttaccgtggtggagagcacgggataaaaatggggag
gaaggctacatccctagtaactacgtcacagaagcagaagactccatagaaatgtatgag
tggtattccaaacacatgactcgaagtcaagctgagcaactgctaaagcaagaagggaaa
gaaggaggtttcattgttagagactccagcaaagctggaaaatacactgtgtctgtgttt
gctaaatctacaggggaccctcaaggggtgatacgccattatgttgtgtgttccacacct
cagagccagtattacctggctgagaagcaccttttcagcaccatccctgagctcattaac
taccaccagcataactctgcaggactcatatccaggctcaaatatccagtgtctcaacaa
aataagaacgcgccttccactgcgggcctgggttacggatcatgggaaatagatccaaag
gacctgacattcttgaaggagctggggactggacaatttggggtagtaaagtacgggaaa
tggagaggccagtatgacgtggccatcaagatgatcaaggaaggctccatgtccgaggat
gagttcattgaagaagccaaagtcatgatgaatctttcccatgagaagctggtgcagttg
tatggcgtctgcaccaaacagcgtcccatctttatcatcactgagtacatggccaatggc
tgcctcctgaactacctgagggagatgcgacaccgcttccagactcagcagctgctggag
atgtgcaaggatgtctgtgaagccatggaatacctggagtcaaagcagttccttcaccga
gacctggctgctcgaaactgtttggttaacgaccaaggagttgttaaagtatctgacttt
ggcctgtccaggtatgtcctggatgatgaatatacaagctcagtaggctccaaatttcca
gtccggtggtctccaccagaagtccttatgtacagcaagttcagcagcaaatctgacatt
tgggcttttggggttttgatgtgggaaatctactctctagggaagatgccatatgagaga
tttactaacagtgagaccgccgaacacattgcccaaggcctacgcctctacaggcctcat
ctggcttctgagagggtatataccatcatgtacagctgctggcatgagaaagcagatgaa
cgtcccactttcaaaattcttctgagcaacattctagatgtcatggatgaagaatcctga

DBGET integrated database retrieval system