KEGG   Loxodonta africana (African savanna elephant): 100670398
Entry
100670398         CDS       T04351                                 

Gene name
PTHLH
Definition
(RefSeq) parathyroid hormone-related protein isoform X1
  KO
K22608  parathyroid hormone-related hormone
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04928  Parathyroid hormone synthesis, secretion and action
Brite
KEGG Orthology (KO) [BR:lav00001]
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    100670398 (PTHLH)
SSDB
Motif
Pfam: Parathyroid
Other DBs
NCBI-GeneID: 100670398
NCBI-ProteinID: XP_010593908
LinkDB
Position
Unknown
AA seq 222 aa
MMLRRLVQQWSVAVFLLSYSVPSSGRSLEGLGRRLKRAVSEHQLLHDKGKSIQDLRRRFF
LHHLIAEIHTAEIRATSEASPNSKPPPNTKNHPVRFGSDDEGRYLTQETNKVETYKEQPL
KTPGKKKKGKPGKRKEQEKKKRRTRSAWLDSGVPGSRLEGDHLSDISATSLESNLCTALL
WGLKEENNTRTHHTQPMIPLFKEPPVTSPVFSTDSGRHRITE
NT seq 669 nt   +upstreamnt  +downstreamnt
atgatgctgcggaggctggttcagcagtggagcgtcgcagtgttcctgctgagttactct
gtgccctcctctgggcgctcgttggaggggctcggccgccggctcaaaagagctgtgtca
gaacatcagctcctccatgacaagggaaagtccattcaagatttacggcgacgattcttt
cttcaccatctgattgcagaaatccacacagctgaaatcagggctacctcagaggcttcc
cctaactccaagcctcctcccaacacaaagaaccaccctgtccgatttgggtctgatgat
gagggcagatacctaactcaggaaaccaacaaggtggagacatataaagagcagccactg
aagacacctgggaaaaaaaagaaaggcaagcctgggaaacgcaaggaacaggaaaagaaa
aaacggcgaactcgatctgcctggttagactctggagtacctgggagtcggctggaaggg
gaccacctgtctgacatctccgcaacttcgctggagagcaatttatgtacagcacttcta
tggggtttgaaagaggaaaacaacacaagaacgcatcatacgcagccaatgatcccatta
tttaaagagccccctgtgacttctccagtcttttccactgactctggtagacataggatt
acagagtga

DBGET integrated database retrieval system