KEGG   Loxodonta africana (African savanna elephant): 100670432
Entry
100670432         CDS       T04351                                 

Gene name
JUN
Definition
(RefSeq) transcription factor AP-1
  KO
K04448  transcription factor AP-1
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav01522  Endocrine resistance
lav04010  MAPK signaling pathway
lav04012  ErbB signaling pathway
lav04024  cAMP signaling pathway
lav04137  Mitophagy - animal
lav04210  Apoptosis
lav04310  Wnt signaling pathway
lav04380  Osteoclast differentiation
lav04510  Focal adhesion
lav04530  Tight junction
lav04620  Toll-like receptor signaling pathway
lav04621  NOD-like receptor signaling pathway
lav04625  C-type lectin receptor signaling pathway
lav04657  IL-17 signaling pathway
lav04658  Th1 and Th2 cell differentiation
lav04659  Th17 cell differentiation
lav04660  T cell receptor signaling pathway
lav04662  B cell receptor signaling pathway
lav04668  TNF signaling pathway
lav04722  Neurotrophin signaling pathway
lav04912  GnRH signaling pathway
lav04915  Estrogen signaling pathway
lav04921  Oxytocin signaling pathway
lav04926  Relaxin signaling pathway
lav04932  Non-alcoholic fatty liver disease
lav04933  AGE-RAGE signaling pathway in diabetic complications
lav05030  Cocaine addiction
lav05031  Amphetamine addiction
lav05132  Salmonella infection
lav05133  Pertussis
lav05135  Yersinia infection
lav05140  Leishmaniasis
lav05142  Chagas disease
lav05161  Hepatitis B
lav05162  Measles
lav05166  Human T-cell leukemia virus 1 infection
lav05167  Kaposi sarcoma-associated herpesvirus infection
lav05169  Epstein-Barr virus infection
lav05170  Human immunodeficiency virus 1 infection
lav05171  Coronavirus disease - COVID-19
lav05200  Pathways in cancer
lav05203  Viral carcinogenesis
lav05210  Colorectal cancer
lav05211  Renal cell carcinoma
lav05224  Breast cancer
lav05231  Choline metabolism in cancer
lav05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
lav05321  Inflammatory bowel disease
lav05323  Rheumatoid arthritis
lav05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100670432 (JUN)
   04012 ErbB signaling pathway
    100670432 (JUN)
   04310 Wnt signaling pathway
    100670432 (JUN)
   04668 TNF signaling pathway
    100670432 (JUN)
   04024 cAMP signaling pathway
    100670432 (JUN)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    100670432 (JUN)
  09143 Cell growth and death
   04210 Apoptosis
    100670432 (JUN)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100670432 (JUN)
   04530 Tight junction
    100670432 (JUN)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100670432 (JUN)
   04621 NOD-like receptor signaling pathway
    100670432 (JUN)
   04625 C-type lectin receptor signaling pathway
    100670432 (JUN)
   04660 T cell receptor signaling pathway
    100670432 (JUN)
   04658 Th1 and Th2 cell differentiation
    100670432 (JUN)
   04659 Th17 cell differentiation
    100670432 (JUN)
   04657 IL-17 signaling pathway
    100670432 (JUN)
   04662 B cell receptor signaling pathway
    100670432 (JUN)
  09152 Endocrine system
   04912 GnRH signaling pathway
    100670432 (JUN)
   04915 Estrogen signaling pathway
    100670432 (JUN)
   04921 Oxytocin signaling pathway
    100670432 (JUN)
   04926 Relaxin signaling pathway
    100670432 (JUN)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100670432 (JUN)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100670432 (JUN)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100670432 (JUN)
   05203 Viral carcinogenesis
    100670432 (JUN)
   05231 Choline metabolism in cancer
    100670432 (JUN)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100670432 (JUN)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100670432 (JUN)
   05211 Renal cell carcinoma
    100670432 (JUN)
   05224 Breast cancer
    100670432 (JUN)
  09163 Immune disease
   05323 Rheumatoid arthritis
    100670432 (JUN)
   05321 Inflammatory bowel disease
    100670432 (JUN)
  09165 Substance dependence
   05030 Cocaine addiction
    100670432 (JUN)
   05031 Amphetamine addiction
    100670432 (JUN)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100670432 (JUN)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100670432 (JUN)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100670432 (JUN)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100670432 (JUN)
   05135 Yersinia infection
    100670432 (JUN)
   05133 Pertussis
    100670432 (JUN)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100670432 (JUN)
   05170 Human immunodeficiency virus 1 infection
    100670432 (JUN)
   05161 Hepatitis B
    100670432 (JUN)
   05171 Coronavirus disease - COVID-19
    100670432 (JUN)
   05162 Measles
    100670432 (JUN)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100670432 (JUN)
   05169 Epstein-Barr virus infection
    100670432 (JUN)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    100670432 (JUN)
   05142 Chagas disease
    100670432 (JUN)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100670432 (JUN)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:lav03000]
    100670432 (JUN)
Transcription factors [BR:lav03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, Jun
    100670432 (JUN)
SSDB
Motif
Pfam: Jun bZIP_1 bZIP_2 bZIP_Maf ZapB PspA_IM30 TFIIA FlaC_arch NBP1 Fib_alpha DUF3450 Jnk-SapK_ap_N TMF_DNA_bd
Other DBs
NCBI-GeneID: 100670432
NCBI-ProteinID: XP_010589533
UniProt: G3TME6
LinkDB
Position
Unknown
AA seq 329 aa
MTAKMETTFYDDALNVSFLQSESGAYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDL
LTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAE
LHSQNTLPSVTSAAQPVSGAGMVAPAVASVAGGSGGFSASLHSEPPVYANLSNFNPGALS
SGGGAPSYGAGGLAFPAQPQQQPQPPHHLPQQIPVQHPRLQALKEEPQTVPEMPGETPPL
SPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELASTANMLR
EQVAQLKQKVMNHVNSGCQLMLTQQLQTF
NT seq 990 nt   +upstreamnt  +downstreamnt
atgactgcaaagatggaaacgaccttctatgacgatgccctcaacgtctccttcctccag
tccgagagcggcgcctacggctacagtaaccccaagatcctgaaacagagcatgaccctg
aacctggctgacccggtgggcagcctgaagccgcacctccgcgccaagaactcggacctc
ctcacctcgcccgacgtcgggctgctcaagttggcgtcgcccgagctggagcgcctgatt
atccagtccagcaacgggcacatcaccaccacgccgacccctacccagttcctgtgcccc
aagaacgtgacggacgagcaggagggcttcgccgagggcttcgtgcgcgccctggccgaa
ctgcacagccagaacactttgccaagcgtcacgtccgcggcgcagccggtcagcggggcg
ggcatggtggccccggcggtggcttccgtggcgggcggcagcggcggtttcagcgccagc
ctgcacagcgagccgccagtctacgccaaccttagcaacttcaacccgggcgcgttgagc
agcggcggcggggcgccctcctatggcgccggcggcctggcctttcccgcgcagcctcaa
cagcagccgcagccgccacatcacctgccccagcagatccccgtgcagcaccctcgactc
caggccctaaaggaggagccgcagacggtccccgagatgcccggggagacgccgcccctg
tcccccatcgacatggagtcacaggagcggatcaaggcggaaaggaagcgcatgaggaac
cgcatcgctgcctccaagtgccggaaaagaaagctggagaggatcgcccggctggaggaa
aaagtgaaaactttgaaagcgcagaactcggagctggcgtccacggccaatatgctcagg
gaacaggtggcacagcttaaacagaaagtcatgaaccacgttaatagtgggtgccaactc
atgctaacgcagcagttgcaaacgttttga

DBGET integrated database retrieval system