KEGG   Loxodonta africana (African savanna elephant): 100670517
Entry
100670517         CDS       T04351                                 

Gene name
SLC38A3
Definition
(RefSeq) sodium-coupled neutral amino acid transporter 3 isoform X1
  KO
K13576  solute carrier family 38 (sodium-coupled neutral amino acid transporter), member 3
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04724  Glutamatergic synapse
lav04727  GABAergic synapse
lav04964  Proximal tubule bicarbonate reclamation
Brite
KEGG Orthology (KO) [BR:lav00001]
 09150 Organismal Systems
  09155 Excretory system
   04964 Proximal tubule bicarbonate reclamation
    100670517 (SLC38A3)
  09156 Nervous system
   04724 Glutamatergic synapse
    100670517 (SLC38A3)
   04727 GABAergic synapse
    100670517 (SLC38A3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:lav02000]
    100670517 (SLC38A3)
Transporters [BR:lav02000]
 Solute carrier family (SLC)
  SLC38: System A and System N sodium-coupled neutral amino acid transporter
   100670517 (SLC38A3)
SSDB
Motif
Pfam: Aa_trans DUF3262
Other DBs
NCBI-GeneID: 100670517
NCBI-ProteinID: XP_003410145
UniProt: G3U0W2
LinkDB
Position
Unknown
AA seq 503 aa
MEAPLQTEMVELVPNGKHSEGLLPATTPTADNQRVEGPRRSYVEGEDFLQKSPSKEPHFT
DFEGKTSFGMSVFNLSNAIMGSGILGLAYAMANTGIILFLFLLTAVALLSSYSIHLLLKS
SGIVGIRAYEQLGYRAFGMPGKLAAALAIALQNIGAMCSYLYIIKSELPLVIQTFLNLEE
KTSDWYVNGNYLVILVSITVILPLALMRQLGYLGYSSGFSLSCMVFFLIAVIYKKFHVPC
PLPLNVTNIVGNSSHVVIEEEAQLQVETEAAAFCTPSYFTLNTQTAYTVPIMAFAFVCHP
EVLPIYTELKDPTKRKMQHISNLSIAVMYVMYFLAALFGYLTFYDGVESELLHTYNNVDP
FDVLILCVRVAVLTAVTLTVPIVLFPVRRAIQQMLFQNQEFSWLRHVLIATSLLTCINLL
VIFAPNILGIFGIIGATSAPCLIFIFPAIFYFRIVPTEKEPARSTPKILALCFAMLGLLL
MTMSLSFIIIDWVSGTSQHGGSH
NT seq 1512 nt   +upstreamnt  +downstreamnt
atggaggcacctctgcagacggagatggtggagctggtacccaatggcaaacactcggag
gggctgctcccagccaccacccctacggcggacaaccagagagtcgagggccccagaagg
agctatgttgagggcgaggactttctgcagaaaagcccaagcaaggagccacacttcact
gacttcgaggggaagacatcgtttgggatgtcagtgttcaacctcagcaacgccatcatg
ggcagtggcatcctcgggctcgcctatgccatggccaatacaggcatcatccttttcctg
ttcctgttgacagccgtcgccctgctctccagctactccatccacctgctgctcaagtcc
tcggggatcgtgggcatccgtgcctatgagcagctgggctaccgtgccttcggaatgccg
gggaagctggctgcagccctggccatcgccctacagaacattggtgccatgtgcagctac
ctgtacatcatcaagtcggagctgcctcttgtcatacagaccttcctgaacctggaagag
aaaacttcggactggtacgtgaatggaaactacctggtgatcctagtctctatcaccgtc
attttgcccttagcacttatgcggcagctcggctacctgggctactcaagtggcttctct
ctcagctgcatggtgttcttcctaattgcagtcatctacaaaaagttccatgtgccctgc
ccgttgcccctcaacgttaccaacatcgtgggcaactccagccacgtggtcatcgaagag
gaggcacagctgcaggtggagactgaggctgcagccttctgcaccccgagctacttcaca
ctcaacacacagacggcgtacaccgtccccatcatggccttcgccttcgtctgccaccct
gaggtgctgcccatctatacagagctcaaggaccccaccaagaggaagatgcaacacatc
tccaacctgtccattgccgtcatgtacgtcatgtacttcctggctgccctcttcggctac
ctcaccttctacgacggggtggagtcggagctgctgcacacctacaacaacgtggacccg
tttgatgtgctgattctgtgtgtgcgagtggcagtgctgacggcagtcacactcacagtg
ccaatcgttctgttcccggtacgccgggccatccagcagatgctatttcagaaccaggag
ttcagctggctgcggcacgtgctcatcgccaccagcctgctcacttgtatcaaccttctg
gtcatctttgctcccaacatcctgggcatctttgggatcattggtgccacatctgcccca
tgcctcatattcatctttcctgccatcttctacttccgcatcgtgcccactgagaaggag
cctgcgaggtccacccctaaaatcctggccctttgcttcgccatgcttggtctcttgttg
atgaccatgagcctgagcttcatcatcattgactgggtctccgggaccagccagcatgga
ggaagccactag

DBGET integrated database retrieval system