KEGG   Loxodonta africana (African savanna elephant): 100670735
Entry
100670735         CDS       T04351                                 

Gene name
PDGFRA
Definition
(RefSeq) platelet-derived growth factor receptor alpha isoform X1
  KO
K04363  platelet-derived growth factor receptor alpha [EC:2.7.10.1]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav01521  EGFR tyrosine kinase inhibitor resistance
lav04010  MAPK signaling pathway
lav04014  Ras signaling pathway
lav04015  Rap1 signaling pathway
lav04020  Calcium signaling pathway
lav04072  Phospholipase D signaling pathway
lav04144  Endocytosis
lav04151  PI3K-Akt signaling pathway
lav04510  Focal adhesion
lav04540  Gap junction
lav04630  JAK-STAT signaling pathway
lav04810  Regulation of actin cytoskeleton
lav05163  Human cytomegalovirus infection
lav05200  Pathways in cancer
lav05206  MicroRNAs in cancer
lav05214  Glioma
lav05215  Prostate cancer
lav05218  Melanoma
lav05230  Central carbon metabolism in cancer
lav05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100670735 (PDGFRA)
   04014 Ras signaling pathway
    100670735 (PDGFRA)
   04015 Rap1 signaling pathway
    100670735 (PDGFRA)
   04630 JAK-STAT signaling pathway
    100670735 (PDGFRA)
   04020 Calcium signaling pathway
    100670735 (PDGFRA)
   04072 Phospholipase D signaling pathway
    100670735 (PDGFRA)
   04151 PI3K-Akt signaling pathway
    100670735 (PDGFRA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100670735 (PDGFRA)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100670735 (PDGFRA)
   04540 Gap junction
    100670735 (PDGFRA)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100670735 (PDGFRA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100670735 (PDGFRA)
   05206 MicroRNAs in cancer
    100670735 (PDGFRA)
   05230 Central carbon metabolism in cancer
    100670735 (PDGFRA)
   05231 Choline metabolism in cancer
    100670735 (PDGFRA)
  09162 Cancer: specific types
   05214 Glioma
    100670735 (PDGFRA)
   05218 Melanoma
    100670735 (PDGFRA)
   05215 Prostate cancer
    100670735 (PDGFRA)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    100670735 (PDGFRA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100670735 (PDGFRA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lav01001]
    100670735 (PDGFRA)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:lav04090]
    100670735 (PDGFRA)
Enzymes [BR:lav01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     100670735 (PDGFRA)
Protein kinases [BR:lav01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   100670735 (PDGFRA)
CD molecules [BR:lav04090]
 Proteins
  100670735 (PDGFRA)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ig_3 I-set ig Ig_2 V-set Herpes_gE C2-set_2 Kinase-like LAT DUF3475
Other DBs
NCBI-GeneID: 100670735
NCBI-ProteinID: XP_023410821
LinkDB
Position
Unknown
AA seq 1078 aa
MFPFTGPGLILCQLSLPSILPNENEKVVQLNSSFSLRCFGESEVNWQYPMSEDENHSVEI
RNEENNSGLFVTVLEVTGASAAHTGLYTCYYNHTLTEENEVKGRRIYIYVPDPDVVFIPL
GMMDYLVITEEDDSAIIPCRTTDPETPVTLLSGDRVVHASYDSKQGFNGTFPVGSYICEA
TIKGKTFQTIPFNVYTLKATSELDLEMEALKTVYKSGEKIEVTCVVFNNEVVDLQWTYPG
EVKGKGVTMLEEIKVPTIKLVYTLTIPKATVKDSGDYECAARQATKEVKEMKKVTISVHE
KGFIEIKPNFSQLEAVNLHEVKHFVVDIKAYPPPRISWLKDNLTLIENLTEITTDVDRIQ
EIRYRSKLKLIRAKEEDSGHYTIVVQNEDDVKSYTFELLTQVPSSILDLVDDHHGSTGVQ
TVKCMAAGTPLPDIEWMICKDIKKCNNETSWTILANNVSNIITEIHSRDRSTVEGQVTFT
KVEETIAVRCLAKNLLGVENRELKLVAPTLRSELTVAAAVLVLLVIVIISLIVLVVIWKQ
KPRYEIRWRVIESISPDGHEYIYVDPMQLPYDSRWEFPRDGLVLGRILGSGAFGKVVEGT
AYGLSRSQPVMKVAVKMLKPTARSSEKQALMSELKIMTHLGPHLNIVNLLGACTKSGPIY
IITEYCFYGDLVNYLHKNRDSFLSHHPEKPKKELDIFGLNPADESTRSYVILSFENNGDY
MDMKQADTTQYVPMLERKEVSKYSDIQRSLYDRPASYKKKSMLDSEVKNLLSDDNSEGLT
LLDLLSFTYQVARGMEFLASKNCVHRDLAARNVLLAQGKIVKICDFGLARDIMHDSNYVS
KGSTFLPVKWMAPESIFDNLYTTLSDVWSYGILLWEIFSLGGTPYPGMMVDSTFYNKIKS
GYRMAKPDHATSEVYEIMVKCWNSEPEKRPSFYHLSEIVENLLPGQYKKSYEKIHLDFLK
SDHPAVARMRVDSDNAYIGVTYKNEEDKLKDWEGGLDEQRLSADSGYIIPLPDIDPVPED
EDLGKRNRHSSQTSEESAIETGSSSSTFIKREDETIEDIDMMDDIGIDSSDLVEDSFL
NT seq 3237 nt   +upstreamnt  +downstreamnt
atgtttccttttacagggccggggctaatactctgccagctttcactaccctccatcctt
ccaaatgaaaatgaaaaggttgtgcagctgaattcctccttttctctgagatgctttggg
gagagtgaagtgaactggcagtaccccatgtctgaagatgagaaccacagtgtggaaatc
cgaaacgaggaaaacaacagtggcctttttgtgacagtgctggaagtgaccggtgcctcg
gcggcccacacaggactgtacacttgctactacaaccacactctgacagaagaaaatgag
gtcaaaggcaggcgtatttatatctacgtgccggacccagacgtagtcttcatacctctg
ggaatgatggattatttggtcatcacggaggaggatgattctgccatcataccctgccga
acgactgaccctgagaccccagtcaccttactcagtggcgatagggtggttcatgcctcc
tatgacagcaaacagggctttaacggaactttccctgtggggtcctacatctgtgaggcc
accatcaaagggaagacgttccagaccatcccttttaacgtgtatactttaaaagcaaca
tcagaacttgacctagaaatggaagctcttaaaactgtgtataaatcaggggagaagatt
gaggtcacttgtgtagtctttaacaatgaagtggttgaccttcagtggacttaccctgga
gaagtgaaaggcaaaggtgtcacaatgctcgaggaaatcaaggttccaaccatcaagctg
gtgtacactttgacaatccccaaggccacagtgaaagacagtggagattacgaatgtgct
gcccgccaggccaccaaggaggtcaaagaaatgaagaaagtcaccatttctgttcatgag
aaaggattcattgaaatcaaacccaacttcagccagttggaagctgtcaacctgcatgaa
gtcaaacattttgtggtggacataaaggcctaccctcctcctaggatatcctggctgaag
gacaacctgacgctgattgaaaacctgaccgagatcactactgatgtagacaggattcag
gagataaggtatcgaagtaaattaaagctgatccgtgctaaggaagaagacagtggccat
tatactattgtagttcaaaatgaagatgatgtgaagagctatacttttgaactattaact
caagttccctcctctattctggacttggttgatgaccaccatggctctactggggtgcag
actgtgaagtgcatggcagcaggaacccctcttcctgacattgagtggatgatttgcaag
gatattaaaaaatgcaataatgaaacttcatggacgattttggccaacaatgtctcaaac
atcatcactgaaatccactcccgagaccggagtaccgtggagggccaagttactttcacc
aaagtagaggagaccattgcagttcgatgcctggctaagaatcttcttggggtggagaac
cgagagctgaagctcgtggctcccactctgcgttctgaactcactgtggcggctgcagtc
ttggtgctattggtgattgtgatcatctcacttattgtcctggtcgtcatttggaaacag
aaaccgaggtatgaaattcgttggagggtcattgaatcaatcagccctgatggacatgaa
tatatttatgtggaccccatgcagctgccttatgactccagatgggagtttccaagagat
ggactagtgcttggtcgtatcctgggatctggtgcctttgggaaagtggttgaaggaacg
gcctatggattaagccgttctcagcctgtgatgaaagtagcagtgaagatgctaaaaccc
acagccagatccagtgaaaaacaagctctcatgtctgaactgaagattatgactcacctg
gggccacatttaaacattgtaaacttgttgggggcctgtaccaaatcaggacccatttac
atcatcactgagtactgcttctatggggatttggtcaattatttgcataagaatagagac
agctttctgagtcaccacccagagaagccaaagaaagagttggacatctttggattgaac
cccgctgatgaaagcacacggagttacgttattttatcttttgaaaacaatggtgactac
atggacatgaaacaagccgataccacacagtatgtccccatgctggaaaggaaagaggtc
tctaagtattcagacatccagagatctttgtatgatcgcccagcctcgtataagaagaaa
tctatgttagactcagaagtcaaaaacctcctctcggatgataactcagaaggccttact
ttgttggatttgttgagcttcacctatcaagttgcccgaggaatggagtttttggcttca
aaaaattgtgtccaccgggacctggctgctcgcaatgtcctcctggctcaggggaaaatt
gtgaagatctgtgactttggcctggccagagatatcatgcatgattctaactacgtgtca
aaaggcagcaccttcctccccgtgaagtggatggctcctgagagcatctttgacaacctc
tacaccaccctgagcgacgtctggtcttatggcatcctgctttgggagatcttctctctt
ggtggcacaccctaccctggcatgatggtggattcgactttttacaataagataaagagt
gggtaccgaatggccaaacccgaccatgccaccagtgaagtctacgagatcatggtgaag
tgctggaacagtgagccagagaagagaccctccttctaccacctgagtgaaattgtggag
aatctgctgcctggacaatataagaagagttatgagaaaattcacctggacttcctgaag
agtgaccatcctgctgtggcacgcatgcgtgtggactctgacaacgcgtacattggcgtc
acctataaaaacgaggaagataagctgaaggactgggagggtggccttgatgagcagaga
ctgagcgcggacagtggctacatcatccctctgcctgacatcgaccctgttcctgaggat
gaagacctgggcaagaggaacagacacagctcacagacctctgaagagagtgctattgag
acaggttccagcagttctacctttatcaagagagaggatgagaccattgaggacatcgac
atgatggacgacattggcatagactcctcagacctggtggaggacagcttcctgtaa

DBGET integrated database retrieval system