KEGG   Loxodonta africana (African savanna elephant): 100670753
Entry
100670753         CDS       T04351                                 

Gene name
ATP2A2
Definition
(RefSeq) sarcoplasmic/endoplasmic reticulum calcium ATPase 2
  KO
K05853  P-type Ca2+ transporter type 2A [EC:7.2.2.10]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04020  Calcium signaling pathway
lav04022  cGMP-PKG signaling pathway
lav04024  cAMP signaling pathway
lav04260  Cardiac muscle contraction
lav04261  Adrenergic signaling in cardiomyocytes
lav04919  Thyroid hormone signaling pathway
lav04972  Pancreatic secretion
lav05010  Alzheimer disease
lav05017  Spinocerebellar ataxia
lav05022  Pathways of neurodegeneration - multiple diseases
lav05410  Hypertrophic cardiomyopathy
lav05412  Arrhythmogenic right ventricular cardiomyopathy
lav05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    100670753 (ATP2A2)
   04024 cAMP signaling pathway
    100670753 (ATP2A2)
   04022 cGMP-PKG signaling pathway
    100670753 (ATP2A2)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    100670753 (ATP2A2)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    100670753 (ATP2A2)
   04261 Adrenergic signaling in cardiomyocytes
    100670753 (ATP2A2)
  09154 Digestive system
   04972 Pancreatic secretion
    100670753 (ATP2A2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100670753 (ATP2A2)
   05017 Spinocerebellar ataxia
    100670753 (ATP2A2)
   05022 Pathways of neurodegeneration - multiple diseases
    100670753 (ATP2A2)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    100670753 (ATP2A2)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    100670753 (ATP2A2)
   05414 Dilated cardiomyopathy
    100670753 (ATP2A2)
Enzymes [BR:lav01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.10  P-type Ca2+ transporter
     100670753 (ATP2A2)
SSDB
Motif
Pfam: E1-E2_ATPase Cation_ATPase_C Cation_ATPase Hydrolase Hydrolase_3 Cation_ATPase_N HAD
Other DBs
NCBI-GeneID: 100670753
NCBI-ProteinID: XP_003420398
LinkDB
Position
Unknown
AA seq 1012 aa
MLLGEFLHFTELPAEEGKTLLELVIEQFEDLLVRILLLAACISFVLAWFEEGEETITAFV
EPFVILLILIANAIVGVWQERNAENAIEALKEYEPEMGKVYRQDRKSVQRIKAKDIVPGD
IVEIAVGDKVPADIRLTSIKSTTLRVDQSILTGESVSVIKHTDPVPDPRAVNQDKKNMLF
SGTNIAAGKAMGVVVATGVNTEIGKIRDEMVATEQERTPLQQKLDEFGEQLSKVISLICI
AVWIINIGHFNDPVHGGSWIRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKK
NAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVCRMFILDRVEGDTCSLNEFTITGSTY
APIGEVHKDDKPVRCHQYDGLVELATICALCNDSALDYNEAKGVYEKVGEATETALTCLV
EKMNVFDTELKGLSKIERANACNSVIKQLMKKEFTLEFSRDRKSMSVYCTPNKPSRTSMS
KMFVKGAPEGVIERCTHIRVGSTKIPITPGVKQKIMSVIREWGSGSDTLRCLALATHDNP
MRREEMNLEDSANFIKYETNLTFVGCVGMLDPPRSEVASSVKLCRQAGIRVIMITGDNKG
TAVAICRRIGIFRQDEDVTSKAFTGREFDELSPSAQRDACLTARCFARVEPSHKSKIVEF
LQSFDEITAMTGDGVNDAPALKKSEIGIAMGSGTAVAKTASEMVLADDNFSTIVAAVEEG
RAIYNNMKQFIRYLISSNVGEVVCIFLTAALGFPEALIPVQLLWVNLVTDGLPATALGFN
PPDLDIMNKPPRNPKEPLISGWLFFRYLAIGCYVGAATVGAAAWWFIAADGGPRVTFYQL
SHFLQCKDDNPDFEGVDCAVFESPYPMTMALSVLVTIEMCNALNSLSENQSLLRMPPWEN
IWLVGSICLSMSLHFLILYVEPLPLIFQITPLNLTQWLMVLKISLPVILMDETLKFVARN
YLEPGKECVQPARPCSLSACTDGISWPFVLLVVPLVVWVYSTDTNFTDMFWS
NT seq 3039 nt   +upstreamnt  +downstreamnt
atgttgcttggcgaatttcttcattttacagagttaccggctgaagaaggaaaaaccttg
ctagaacttgtgattgagcagtttgaagacttactagttagaattttattgctggcagca
tgtatatcttttgttttggcttggtttgaagaaggtgaagaaacaattacagcctttgta
gaaccctttgtaattttacttatattaatagccaatgcaattgtgggtgtatggcaggaa
agaaatgctgaaaatgcaattgaagcccttaaggagtatgagcctgaaatgggcaaagtg
tatcgacaggacagaaagagtgtacagcgaattaaagctaaagacatagttcctggtgat
atcgtagaaatcgctgttggtgacaaagttccagctgatataagactaacttctatcaaa
tctacaactctgagagtagaccagtcgattcttacaggtgaatctgtctctgtcatcaag
cacacggaccctgtccctgacccacgggctgtcaaccaagataagaagaacatgctcttt
tctggcacaaacattgctgctggaaaggccatgggagtggtggtggcaactggagttaac
actgagattggcaagatccgggatgaaatggtggcaacggagcaagagagaacacccctc
cagcagaaactggatgagtttggagaacagctgtccaaagttatctccctcatttgtatt
gccgtctggatcataaacattgggcatttcaatgatcccgttcacggaggttcttggatc
agaggtgctatctactactttaaaattgcggtggccctggctgtcgcagccattcccgaa
ggtctgcctgctgtcatcaccacctgcctggctcttggaacacgcagaatggcaaagaaa
aatgccattgttcgaagccttccctcggtggaaacccttggttgtacttctgttatctgc
tcagacaagactggtacacttacgacaaaccagatgtcggtctgcaggatgttcattctg
gacagggtcgaaggcgatacttgttctcttaatgagttcaccataactggatcaacatat
gcacctataggagaagtgcataaagatgataagccagtaagatgtcatcagtatgatggt
cttgtagaattagcaacaatctgtgctctttgtaatgactctgctttggattacaatgag
gcaaagggcgtgtatgaaaaagttggagaagctacagagactgcactcacgtgtctggta
gagaagatgaatgtattcgatacggaattgaagggtctttctaaaatagaacgtgcaaac
gcctgcaactcggtcattaaacagttgatgaaaaaagaatttaccctagagttttcacgc
gatagaaaatcaatgtcggtttattgcacaccaaacaaaccaagccgaacatccatgagc
aagatgtttgtgaagggcgctcccgagggtgtcattgagaggtgtacccacattcgagtt
ggaagcacgaagattcccataactccgggggtcaagcagaagatcatgtctgttattcgg
gagtggggcagtggcagcgacaccctgcgctgcctggctctggccactcacgacaaccca
atgaggagagaagagatgaaccttgaggactctgccaacttcatcaagtatgagaccaat
ctgaccttcgttggctgcgtgggcatgctggaccccccgagaagtgaagtggcctcgtca
gtgaagttgtgcaggcaggcaggcatccgcgtcatcatgatcacgggggacaacaagggt
accgctgtggccatctgtcgccggattggcatcttccggcaggatgaggatgtgacgtcg
aaggccttcacaggccgggagtttgacgagctcagtccctcagcgcagagggacgcctgc
ttgacggctcgctgcttcgctcgtgtggagccttcccacaagtctaaaatcgtagagttt
cttcagtcttttgatgagattacagctatgactggggacggtgtgaacgatgcgcctgct
ctgaagaagtctgagatcggcatcgccatgggctccggcaccgccgtggccaagactgcc
tctgagatggtcttggctgacgacaacttctccaccattgtggcggccgtcgaggaggga
cgggcaatctacaacaacatgaagcagttcatccgctacctcatctcgtccaacgtcggc
gaggtcgtctgtattttcctgacagcggccctgggttttcctgaggctttaattcctgtc
cagctgctctgggtcaacctggtgacagacggcctacccgctaccgccctgggcttcaac
cctcctgatctggacatcatgaataagccgccccggaaccccaaggagccactgatcagt
gggtggctctttttccgttacctcgcaattggctgttatgttggtgccgctaccgtgggc
gctgctgcatggtggtttatcgctgctgacggcggtccccgggtcaccttctaccagctg
agtcacttcctacagtgtaaagacgacaaccctgattttgaaggagtggattgtgcagtc
tttgaatccccgtacccgatgacaatggcactttctgttctcgtaaccatagagatgtgt
aatgccctcaacagcttgtctgaaaaccagtccttgctgaggatgcccccctgggagaac
atctggctcgtgggctccatctgcctgtccatgtccctccacttcctcatcctctacgtg
gagcccttgcctcttatcttccagatcacaccgctgaacttgacccagtggctgatggtg
ctgaaaatctccctgcccgtgatcctcatggacgagaccctcaagttcgtggcgcgcaac
tacctggagcctggtaaagagtgtgtgcagccggcgcggccatgctcgctctcagcgtgc
accgacggcatctcctggccttttgtgctgctcgtagtgccgctggtggtctgggtctat
agcacagacactaacttcaccgatatgttctggtcttga

KEGG   Loxodonta africana (African savanna elephant): 100671775
Entry
100671775         CDS       T04351                                 

Gene name
ATP2A3
Definition
(RefSeq) sarcoplasmic/endoplasmic reticulum calcium ATPase 3 isoform X6
  KO
K05853  P-type Ca2+ transporter type 2A [EC:7.2.2.10]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04020  Calcium signaling pathway
lav04022  cGMP-PKG signaling pathway
lav04024  cAMP signaling pathway
lav04260  Cardiac muscle contraction
lav04261  Adrenergic signaling in cardiomyocytes
lav04919  Thyroid hormone signaling pathway
lav04972  Pancreatic secretion
lav05010  Alzheimer disease
lav05017  Spinocerebellar ataxia
lav05022  Pathways of neurodegeneration - multiple diseases
lav05410  Hypertrophic cardiomyopathy
lav05412  Arrhythmogenic right ventricular cardiomyopathy
lav05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    100671775 (ATP2A3)
   04024 cAMP signaling pathway
    100671775 (ATP2A3)
   04022 cGMP-PKG signaling pathway
    100671775 (ATP2A3)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    100671775 (ATP2A3)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    100671775 (ATP2A3)
   04261 Adrenergic signaling in cardiomyocytes
    100671775 (ATP2A3)
  09154 Digestive system
   04972 Pancreatic secretion
    100671775 (ATP2A3)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100671775 (ATP2A3)
   05017 Spinocerebellar ataxia
    100671775 (ATP2A3)
   05022 Pathways of neurodegeneration - multiple diseases
    100671775 (ATP2A3)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    100671775 (ATP2A3)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    100671775 (ATP2A3)
   05414 Dilated cardiomyopathy
    100671775 (ATP2A3)
Enzymes [BR:lav01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.10  P-type Ca2+ transporter
     100671775 (ATP2A3)
SSDB
Motif
Pfam: E1-E2_ATPase Cation_ATPase_C Hydrolase Cation_ATPase_N Cation_ATPase Hydrolase_3 HAD DUF3106
Other DBs
NCBI-GeneID: 100671775
NCBI-ProteinID: XP_010594815
LinkDB
Position
Unknown
AA seq 999 aa
MEAAHLLPAADVLRRFAVTAECGLSPAQVTDARERYGPNELPTEEGKSLWELVLEQFEDL
LVRILLLAALVSFVLAWFEEGEETTTAFVEPLVIMLILVANAIVGVWQERNAESAIEALK
EYEPEMGKVIRSDRKGVQRIRARDIVPGDIVEVAVGDKVPADLRLIEIKSTTLRVDQSIL
TGESVSVTKHTDAISDARAVNQDKKNMLFSGTNIASGKAVGVAVATGLHTELGKIRSQMA
AVEPERTPLQRKLDEFGRQLSRAISVICVAVWVINIGHFADPVHGGSWLRGAVYYFKIAV
ALAVAAIPEGLPAVITTCLALGTRRMARKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQ
MSVCRMFVVAEAEAGSCRLHEFTISGTTYTPEGEVRQGEKPVRCGEFDSLVELATICALC
NDSALDYNEAKGIYEKVGEATETALTCLVEKMNVFDTDLQALSRVERAGACNTVIKQLMR
KEFTLEFSRDRKSMSVYCTPIRPGSAAQGSKMFVKGAPESVIERCISVRVGSRTVPLNTA
SRAQILAKIRDWGSGSDTLRCLALATRDMPPRKEDMQLDDCSKFAQYETDLTFVGCVGML
DPPRPEVAACIARCCQAGIRVVMITGDNKGTAVAICRRLGIFGDTEDVVGRAYTGREFDD
LSPEQQRHACQTARCFARVEPAHKSRIVEYLQSFNEVTAMTGDGVNDAPALKKAEIGIAM
GSGTAVAKSAAEMVLSDDNFASIVSAVEEGRAIYSNMKQFIRYLISSNVGEVVCIFLTAI
LGLPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMEKPPRNPHEALISGWLFFRYLAI
GVYVGLATVAAATWWFLYDAEGPHVTFYQLRNFLKCSKENPLFADEVDCKVFESRFPTTM
ALSVLVTIEMCNALNSVSENQSLLRMPPWLNPWLLAAVAMSMALHFLILLVPPLPLIFQV
TPLSGRQWVVVLQISLPVILLDEALKYLSRNHMDEKGQK
NT seq 3000 nt   +upstreamnt  +downstreamnt
atggaggcggcgcacctgctcccggccgccgacgtgctgcgccgctttgcggtgaccgcc
gagtgcggcctgagcccggcgcaggtgaccgacgcgcgggagcgctacggccccaacgag
ctcccgacggaggaagggaagtccctgtgggagctggtgctggagcagtttgaagacctc
ctggtgcgcatcctgctgctggccgccctggtctccttcgtcctggcctggttcgaggaa
ggtgaggagaccacgacagccttcgtggagcctctggtcatcatgctgatcctcgtggcc
aatgcgatcgtgggcgtatggcaggaacgcaatgctgagagtgccattgaggccctaaag
gaatacgagcctgagatgggcaaggtgatccgctcagaccgcaagggtgtgcagaggatc
cgtgcccgggacattgtccccggagatattgtggaagtggcagtcggggacaaagtgcct
gctgacctccgcctcattgagatcaagtccaccacgctgcgagtggaccagtccatcctg
acaggtgaatctgtgtcggtgaccaagcacacagatgccatctcagacgcgagagctgtg
aaccaggacaagaagaacatgctgttttctggcaccaacattgcgtcaggcaaggcggtg
ggcgtagctgtggccacaggcctgcacacggagctgggcaagatccggagccagatggcg
gcggtggagccggagcggacaccgctgcagcgtaagctggatgagttcgggcggcagctg
tcccgtgccatctctgtgatctgcgtggctgtgtgggtcatcaacatcggccattttgcc
gacccagtccacggcggctcctggctccgtggtgccgtctactacttcaagattgctgtg
gccttggctgtggccgccatccctgagggcctcccggctgtcatcactacatgcctggca
ctgggcacccggcgcatggcacgcaagaatgccatcgtgcggagcttgccctctgtggag
accttgggctgcacctcagtcatctgctctgacaagaccggcacactcaccaccaaccag
atgtccgtctgccggatgttcgtggtggccgaggccgaggctggctcctgccgtttgcac
gaattcaccatctcgggtaccacctacaccccggagggcgaagtgcggcagggagaaaag
cctgtgcgctgtggagagtttgacagtttggtggagctggcgaccatctgtgcgctgtgc
aatgactcggcgctggactacaacgaggccaagggcatatatgagaaagtgggagaggct
acggagacagctttgacttgcctggtggagaagatgaacgtgtttgacaccgacctccag
gccctgtcccgagtggagcgagccggtgcctgcaacacagtcatcaaacagctgatgcgg
aaggagttcacccttgagttctcccgagaccggaagtccatgtcagtgtactgcacgccc
atccgccctggctcagcagcccagggcagcaagatgtttgtgaagggggctcctgaaagt
gtgatcgagcgctgcatctcagtccgcgtgggaagccgcacagtacctctgaacactgcc
tccagggcgcagatcctggcaaaaatccgggattggggctcaggctcggacacactacgc
tgcctggcgctggccacccgggatatgcccccgaggaaggaggacatgcagctggatgac
tgcagcaagtttgcccagtatgagacggacctgaccttcgtgggctgtgtgggcatgctg
gacccaccaaggcctgaggtggctgcttgtattgcccgctgctgccaggcgggcatccgc
gtggtcatgatcacaggggacaacaaaggcacggccgtggccatctgccgccggcttggc
atcttcggggacacggaggacgtggtgggcagggcatacacaggtcgtgagtttgatgac
ctcagccctgagcagcagcgccatgcctgccagacggctcgctgctttgcccgtgtggag
cctgcgcacaagtcccgcatcgtggagtacctacagtcctttaatgaggtcaccgccatg
actggtgacggggtgaacgatgccccagccctgaagaaagcagagattggcatcgccatg
ggctcaggcacagccgtggccaagtcagcagcggagatggtgctgtcagatgacaacttt
gcctccatcgtgtctgcggtggaggagggccgagctatctacagcaacatgaagcaattc
atccgctacctcatctcctccaacgtcggcgaggtcgtctgcatcttcctcacggcaatt
ctgggcctgcccgaagccctgatccctgtgcagctgctctgggtgaacctggtgacggat
ggcttacctgccacggccctgggctttaacccaccagacctggacatcatggagaagcca
ccccggaacccccatgaggccctcatcagtggctggctcttcttccgctatctggctatt
ggcgtgtacgtgggcctggccacagtggctgctgccacctggtggttcctgtatgatgca
gagggacctcacgtcactttctaccagctgaggaacttcctgaagtgttccaaggaaaac
ccactctttgccgacgaggtggactgcaaggtcttcgagtcccgcttcccaaccaccatg
gccttgtccgtgctggtgaccattgagatgtgcaacgccctcaacagcgtctcggagaac
cagtcgctgttgcggatgccaccctggctgaacccctggctgctggcagccgtggccatg
tccatggccctgcacttcctcatcctgcttgtgccaccccttcccctcattttccaggta
accccactgagtgggcgccagtgggtggtggttctccagatatccctgcctgtcatcctg
ctcgatgaggccctcaagtacctgtcccgaaaccacatggatgaaaagggccagaagtga

KEGG   Loxodonta africana (African savanna elephant): 100676453
Entry
100676453         CDS       T04351                                 

Gene name
ATP2A1
Definition
(RefSeq) sarcoplasmic/endoplasmic reticulum calcium ATPase 1 isoform X2
  KO
K05853  P-type Ca2+ transporter type 2A [EC:7.2.2.10]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04020  Calcium signaling pathway
lav04022  cGMP-PKG signaling pathway
lav04024  cAMP signaling pathway
lav04260  Cardiac muscle contraction
lav04261  Adrenergic signaling in cardiomyocytes
lav04919  Thyroid hormone signaling pathway
lav04972  Pancreatic secretion
lav05010  Alzheimer disease
lav05017  Spinocerebellar ataxia
lav05022  Pathways of neurodegeneration - multiple diseases
lav05410  Hypertrophic cardiomyopathy
lav05412  Arrhythmogenic right ventricular cardiomyopathy
lav05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    100676453 (ATP2A1)
   04024 cAMP signaling pathway
    100676453 (ATP2A1)
   04022 cGMP-PKG signaling pathway
    100676453 (ATP2A1)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    100676453 (ATP2A1)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    100676453 (ATP2A1)
   04261 Adrenergic signaling in cardiomyocytes
    100676453 (ATP2A1)
  09154 Digestive system
   04972 Pancreatic secretion
    100676453 (ATP2A1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100676453 (ATP2A1)
   05017 Spinocerebellar ataxia
    100676453 (ATP2A1)
   05022 Pathways of neurodegeneration - multiple diseases
    100676453 (ATP2A1)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    100676453 (ATP2A1)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    100676453 (ATP2A1)
   05414 Dilated cardiomyopathy
    100676453 (ATP2A1)
Enzymes [BR:lav01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.10  P-type Ca2+ transporter
     100676453 (ATP2A1)
SSDB
Motif
Pfam: E1-E2_ATPase Cation_ATPase_C Cation_ATPase_N Cation_ATPase Hydrolase Hydrolase_3 HAD
Other DBs
NCBI-GeneID: 100676453
NCBI-ProteinID: XP_003418880
LinkDB
Position
Unknown
AA seq 1000 aa
MEAAHSKTTEECLAYFGVSETTGLTPDQVKRHLEKYGHNELPAEEGKSLWELVIEQFEDL
LVRILLLAACISFVLAWFEEGEETVTAFVEPFVILLILIANAIVGVWQERNAENAIEALK
EYEPEMGKVYRADRKAVQRIKARDIVPGDIVEVAVGDKVPADIRILSIKSTTLRVDQSIL
TGESVSVIKHTDPVPDPRAVNQDKKNMLFSGTNIAAGKALGIVASTGVNTEIGKIRDQMA
ATEQDKTPLQQKLDEFGEQLSKVISLICVAVWLINIGHFSDPVHGGSWIRGAIYYFKIAV
ALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQ
MSVCKMFIVDKIDGDFCALNEFSITGSTYAPEGEILKNDKPVRAGQYDGLVELATICALC
NDSSLDFNETKGIYEKVGEATETALTTLVEKMNVFNTDVRSLSKVERANACNSVIRQLMK
KEFTLEFSRDRKSMSVYCSPAKSRAAVGNKMFVKGAPEGVIDRCNYVRVGTTRVPMTGPV
KEKILSVIKEWGTGRDTLRCLALATRDTPPKREDMFLEDSAKFIEYEVDLTFVGVVGMLD
PPRKEVTGSIQLCRDAGIRVIMITGDNKGTAIAICRRIGIFGENEEVAERAYTGREFDDL
PLPEQREACRRACCFARVEPTHKSKIVEYLQSYDEITAMTGDGVNDAPALKKAEIGIAMG
SGTAVAKTASEMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVCIFLTAAL
GLPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMDRPPRTPKEPLISGWLFFRYMAIG
GYVGAATVGAAAWWFMYAEDGPHVTYSQLTHFMKCTEDNAHFEGVDCEVFEASEPMTMAL
SVLVTIEMCNALNSLSENQSLIRMPPWVNIWLVGSIGLSMSLHFLILYIDPLPMIFKLQA
LTVNQWLMVLKISLPVIGLDEILKFIARNYLEDPEDERRK
NT seq 3003 nt   +upstreamnt  +downstreamnt
atggaggctgcacactccaagaccacggaggaatgtttggcctattttggggtgagtgag
accacaggcctcaccccagaccaagttaagcggcacctggagaagtacggccacaatgag
ctccctgctgaggaaggaaagtccctgtgggagttggtgatagagcagtttgaagacctc
ctggtgcgcatccttctcctggccgcctgcatttcctttgtgctggcctggtttgaggaa
ggtgaagagaccgtcacggcctttgttgaacccttcgtcatcctcttgatcctcattgcc
aacgccatagtgggggtttggcaggagcgtaatgcagagaatgccatagaggctctgaag
gaatatgagcctgagatgggaaaggtctaccgggctgatcgaaaggcagtgcaaaggatc
aaggctcgggacattgtccccggggacattgtggaggtggctgtgggggacaaagtccct
gcagatatccgaatcctctccatcaaatccaccaccctccgggttgaccagtccatcctc
acaggtgagtctgtctctgtcatcaagcacacagaccctgttcctgacccccgagctgtc
aaccaggacaagaagaacatgcttttctcgggtaccaacattgcagctggcaaggcctta
ggcattgtggccagcacgggcgtgaacaccgagattgggaagattcgtgaccaaatggct
gccacagaacaggacaagacccctctgcagcagaagctggatgagtttggggagcagctc
tccaaggttatctccctcatctgcgtggccgtctggctcatcaacattggccacttcagt
gatcctgtccatggaggctcttggatccgtggtgccatctactacttcaagattgctgtg
gctctggctgtggctgcaatcccagaaggtcttcctgcagtcatcaccacctgcctggcc
ctggggacccgccggatggcaaagaagaatgctattgtgaggagcttaccctcagttgag
accctgggctgcacctctgtcatctgttccgacaagacaggcaccctcaccaccaaccag
atgtctgtctgcaagatgtttatcgttgacaagatagatggggacttctgcgctctgaat
gagttctccatcactggttccacttatgctccagaaggagagatcttgaagaatgataag
ccagtgcgggcagggcagtatgatgggctggtggagctggccaccatttgtgccctctgc
aatgactcctccttggatttcaatgagaccaaaggtatctatgagaaggtcggtgaggcc
actgagacggcccttaccaccctggtggagaagatgaatgtattcaacactgatgtgaga
agcctctcgaaggtggagagggccaatgcctgcaactcggtgatccgccagctaatgaag
aaggagttcacactggagttctcccgagacagaaagtccatgtctgtctattgctcccca
gccaaatcccgggctgctgtgggcaacaagatgtttgtcaagggtgcccctgagggggtc
atcgatcgctgtaactacgtgcgagttggcacaaccagggtaccgatgacagggccggtg
aaggagaagatcttgtcagtgatcaaggagtggggcaccggccgagacaccctgcgctgc
ctggccctggccacccgggacacccccccgaagcgagaggacatgtttctggaagactct
gcgaagttcatagagtatgaggtggacctgactttcgttggcgtggtgggcatgttggac
ccaccccgcaaggaggtcacaggctccatccagctgtgccgtgatgctggaatccgagta
attatgatcacaggggacaacaagggcacggccatcgccatctgccgacgaattggcatc
tttggcgagaacgaggaggtggcagaacgtgcctacaccggccgggagtttgacgaccta
ccgctgcctgagcagcgggaggcctgccgccgtgcctgctgttttgcccgtgtggagccc
acccacaagtccaagattgtggaatatctgcagtcctacgacgagatcacagccatgaca
ggcgatggcgtcaatgacgcccctgcactgaaaaaggctgagatcggcattgccatggga
tccggcaccgccgtggccaagacggcctcagagatggtgctggcagatgataatttctcc
accatcgtggctgctgtggaggagggccgcgccatctacaacaacatgaagcagttcatc
cgctacctcatttcctccaacgtgggcgaggtggtctgcatcttcctgacagccgctttg
gggctgcccgaggcccttatccctgtgcagctgctgtgggtcaacctggtgacagatggg
ctcccagccacagccctgggcttcaacccgccagacctggacatcatggaccgcccccca
cgcaccccaaaggaacccctcatcagtggctggctcttcttccgctatatggcaattggg
ggctatgtgggtgcagctaccgtgggagcagctgcctggtggttcatgtatgcagaggat
gggcctcatgtcacctacagccagctgactcactttatgaagtgcactgaggacaacgcc
cactttgaaggtgtggactgtgaggtctttgaggcctctgagcccatgaccatggccttg
tctgtgctggtcaccatcgagatgtgcaacgctctcaacagcctgtctgagaaccagtcc
ctcatacggatgccaccatgggtgaacatctggctggtgggctccatcggcctctccatg
tccctccattttctcatcctctacatcgaccccttgccgatgatcttcaagctccaggcc
ttgacagttaaccagtggctcatggtcctcaagatctcacttccagtcatcgggctcgac
gagatcctcaagttcattgctcggaactatctggaggacccagaagatgagagaaggaag
taa

DBGET integrated database retrieval system