KEGG   Loxodonta africana (African savanna elephant): 100670783
Entry
100670783         CDS       T04351                                 

Gene name
GHRHR
Definition
(RefSeq) growth hormone-releasing hormone receptor
  KO
K04584  growth hormone releasing hormone receptor
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04080  Neuroactive ligand-receptor interaction
lav04935  Growth hormone synthesis, secretion and action
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100670783 (GHRHR)
 09150 Organismal Systems
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    100670783 (GHRHR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:lav04030]
    100670783 (GHRHR)
G protein-coupled receptors [BR:lav04030]
 Secretin receptor family
  Hypothalamic hormone
   Growth hormone-releasing hormone (GHRH)
    100670783 (GHRHR)
SSDB
Motif
Pfam: 7tm_2 HRM
Other DBs
NCBI-GeneID: 100670783
NCBI-ProteinID: XP_023400403
LinkDB
Position
Unknown
AA seq 496 aa
MDRRLWGASILCLLNLLPTVSTWLRPSCLSHWAPDLGAPTAQMGAQLESAETPLPTPSTG
VPTMQARALAWRTPDTGAPSFPCPGSLCYLGKPGPSHPRGKGLECVPCRLGLEPRPLQGR
SLSLLPKGSVYASPSRVTQWCPGGEGRNYNLRLCFPPSPFFPGAVKRDCTVTGWSEPFPP
YPVACPVPLELLAEEKSYFSTVKIIYTMGHSISVVTLFVAIAILVALRRLHCPRNYVHTQ
LFATFILKAGAVFLKDATLFHGDNTDHCSFSTALCKISVAASHFATMTNFSWLLAEAVYL
TCLLASTSPSVRCPFWWLALAGWGFPVLFIGTWVGCKWAFEDIACWDLDDSSPYWWIIKG
PIILSVGVNFGLFLNIIRILLRKLEPAQGSLHTQSQYWRLSKSTLFLIPLFGIHYIIFNF
LPDNAGLGLRLPLELGLGSFQGFIVAILYCFLNQEVRTEISRRWHGHDPELLPARRTCAR
CTMPSSSGVKVLTSVC
NT seq 1491 nt   +upstreamnt  +downstreamnt
atggacaggcggctgtggggtgcttccatcctctgcttgctgaacctcttaccgaccgtg
agtacctggctcagaccctcctgcctctcccactgggctcctgatcttggagccccaacg
gcccagatgggggcccagctggagtctgccgagactccactgcccacacccagcacgggg
gtccctaccatgcaggcgcgggccctggcttggagaactcctgacacaggggctccgtcc
ttcccttgtccaggcagcctatgctaccttgggaagcccgggccatcacacccaagagga
aagggcctggagtgtgtcccatgcaggctgggcctggaacccaggcctttgcaaggaagg
tcactttctctgctcccaaaagggtctgtctatgcgagtccttccagggtcactcaatgg
tgtcctgggggagaggggaggaattacaatctgagactctgtttccctccctctcctttc
ttcccaggggctgtgaagcgggattgcaccgtcacgggctggtcggagcccttcccgcct
taccctgtggcctgccctgtgcccctggagctgctggctgaggagaaatcttacttttcc
acggtgaagatcatctataccatgggccacagcatctctgttgtgacactcttcgtggcc
atcgccatcctggttgctctcaggaggctccactgccctcgcaactatgtccacacccag
ctgttcgccacctttatcctcaaagcaggagccgtgttcctgaaggatgccaccctcttc
cacggtgacaacactgaccactgcagcttctccactgctctgtgcaagatctccgtggct
gcctcccattttgccaccatgaccaacttcagctggctgttggccgaagctgtctacctg
acctgtctcttggcttccacgtcacccagtgtgaggtgccccttctggtggctggctctt
gctggctgggggtttccagtgctcttcattgggacctgggtgggctgcaagtgggccttc
gaggatattgcgtgctgggacctggacgacagctccccctactggtggatcatcaagggg
cccatcatcctctctgttggggtgaactttgggctttttctgaatattattcgcatcctg
ttgaggaaactggagccggctcagggcagcctccacactcagtctcagtactggcggctc
tccaagtcaacacttttcctcatccctctgtttggaattcactacatcatcttcaacttc
ctgcctgacaatgccggcctgggccttcgcctgcccctggagctggggctgggctccttt
cagggtttcatcgttgccatcctgtactgcttccttaaccaagaggtgaggactgagatc
tctcgaaggtggcatggccatgaccctgagcttctgccagcccggagaacctgtgccaga
tgtacgatgccctccagctcgggggtgaaggtgctgacatctgtgtgctag

DBGET integrated database retrieval system