KEGG   Loxodonta africana (African savanna elephant): 100670813
Entry
100670813         CDS       T04351                                 

Gene name
TP73
Definition
(RefSeq) LOW QUALITY PROTEIN: tumor protein p73
  KO
K10148  tumor protein p73
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04115  p53 signaling pathway
lav04390  Hippo signaling pathway
lav04722  Neurotrophin signaling pathway
lav05162  Measles
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    100670813 (TP73)
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    100670813 (TP73)
 09150 Organismal Systems
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100670813 (TP73)
 09160 Human Diseases
  09172 Infectious disease: viral
   05162 Measles
    100670813 (TP73)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:lav03000]
    100670813 (TP73)
Transcription factors [BR:lav03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   p53
    100670813 (TP73)
SSDB
Motif
Pfam: P53 P53_tetramer SAM_2 SAM_1
Other DBs
NCBI-GeneID: 100670813
NCBI-ProteinID: XP_010591460
LinkDB
Position
Unknown
AA seq 636 aa
MSQSTSPDGTTFENLWSSLEPDSTYFDLPQSSRENNEVVGSAEASMDVFHLQGMATSVMS
QFNLLSSTMDQMSSRAAPASPYTPEHAASVPTHSPYAQPSSTFDTMSPAPVIPSNTDYPG
PHHFEVTFQQSSTAKSATWTYSPLLKKLYCQIAKTCPIQMKVATPPPPGTAVRAMPVYKK
AEHVTEVVKRCPNHELGRDFNEGQSAPASHLIRVEGNNLSQYVDDPVTGRQSVMVPYEPP
QVGTEFTTILYNFMCNSSCVGGMNRRPILIIITLETRDGQVLGRRSFEGRICACPGRDRK
ADEDHFREQQALNESAAKSGAASKRTFKQSPPAIPSLGANVKKRRHGDEDMYYMPVRGRE
NFEILMRIKEGLELTELVPQQLXDSYRQQQQQLLQRPSHLQPPAYGPVLSPMGKGHGSTS
KLPSVNQLVGQPPPHGSASGPSLGPVGPGVLNSHSHPMPSNGEMNGVHSSQPMVSGSHCT
PPPPYHADPSLVSFLTGLGCPNCIEYFTSQGLQNIYHLQNLTIEDLGALKIPDQYRMTIW
RGLQDLKQGHDYGGSQQLIRASSNAAATLAVGGTGELQRQRXMEAVHFRVRHTITIPGRT
GPXTGPDDWADFGFDLPDCKARRQAIKEELTEGEIH
NT seq 1911 nt   +upstreamnt  +downstreamnt
atgtcccagtccacctcacccgacggaaccacgttcgagaacctctggagctccctggag
ccagacagcacctactttgaccttcctcagtcgagccgggagaacaacgaggtggtgggc
agtgcggaggccagcatggacgtcttccacctgcagggcatggccacttctgtcatgtcc
cagtttaatctgctcagcagcaccatggaccagatgagcagccgcgcagccccggccagc
ccctacaccccggagcacgctgccagtgtgcccacccactcaccctacgcgcagcccagc
tccaccttcgacaccatgtcgcctgcgcctgtcatcccctccaacactgactaccccggc
ccccaccacttcgaggttaccttccagcagtcaagcacagccaagtccgccacctggacg
tactcccccctgttgaagaagctctactgccagattgccaagacgtgccccatccagatg
aaggtggccacgcccccaccccccggcactgcagtccgtgccatgccggtctacaagaag
gcggagcatgtgactgaggtcgtgaagcgctgccccaaccatgagctggggagggacttc
aatgaaggacagtctgccccagccagccacctcatccgcgtggagggcaacaacctctcg
cagtatgtggacgaccccgtcacgggcaggcaaagcgtcatggtgccctacgagccccca
caggtgggaacggaattcaccaccatcctgtacaacttcatgtgcaacagcagctgtgtg
gggggcatgaaccggcggcccatcctcatcatcatcaccctagagacccgggatggacag
gtgctgggccgccggtccttcgagggccgcatctgtgcttgtccaggccgtgaccgaaag
gctgatgaggaccatttccgtgagcagcaggccctgaacgagagcgccgcgaaaagcggg
gcagccagcaaacgcacattcaagcagagccccccggccatcccctctctgggggccaac
gtgaagaagagacggcatggggacgaggatatgtactacatgcccgtgcggggccgggag
aactttgagatcttgatgaggatcaaggagggcctggagctgacggagctggtgccgcag
cagctgngtgactcctaccggcaacagcagcaacagctcctgcagaggccgagccacctg
cagcccccggcttacgggcccgtcctgtcgcccatgggcaaagggcatggcagtaccagc
aaactgccctccgtcaaccagctggtgggccagcctcccccgcacggttcagcaagtggg
cccagcctggggcctgtgggccctggggtgctcaacagccacagccacccgatgccatcc
aatggcgagatgaacggtgtccacagctcgcagcccatggtctcggggtcccactgcacc
ccgccacctccctaccatgcagaccccagcctcgtcagttttctaacaggcttggggtgt
cccaactgcatcgagtatttcacctcgcaggggttacagaacatttatcacctgcagaac
ctcacgatcgaggacctcggggccctgaagatcccagaccagtaccggatgaccatctgg
cggggcctccaggacctgaagcagggccacgactacggtggctcgcagcagctgatccgt
gccagcagcaacgcggcggccacccttgcagtgggtggcacgggtgagctgcagcggcag
cggntcatggaggccgtgcacttccgtgtgcgccacaccatcaccatccctgggcgcacc
gggcccnncactggccccgatgactgggctgactttggcttcgaccttccagactgcaag
gcccgcagacaggccatcaaggaggagctcacagagggtgagattcactga

DBGET integrated database retrieval system