KEGG   Loxodonta africana (African savanna elephant): 100670835
Entry
100670835         CDS       T04351                                 

Gene name
ELK1
Definition
(RefSeq) ETS domain-containing protein Elk-1 isoform X1
  KO
K04375  ETS domain-containing protein Elk-1
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04010  MAPK signaling pathway
lav04012  ErbB signaling pathway
lav04014  Ras signaling pathway
lav04510  Focal adhesion
lav04910  Insulin signaling pathway
lav04912  GnRH signaling pathway
lav04921  Oxytocin signaling pathway
lav05140  Leishmaniasis
lav05161  Hepatitis B
lav05163  Human cytomegalovirus infection
lav05166  Human T-cell leukemia virus 1 infection
lav05200  Pathways in cancer
lav05205  Proteoglycans in cancer
lav05213  Endometrial cancer
lav05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100670835 (ELK1)
   04012 ErbB signaling pathway
    100670835 (ELK1)
   04014 Ras signaling pathway
    100670835 (ELK1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100670835 (ELK1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    100670835 (ELK1)
   04912 GnRH signaling pathway
    100670835 (ELK1)
   04921 Oxytocin signaling pathway
    100670835 (ELK1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100670835 (ELK1)
   05205 Proteoglycans in cancer
    100670835 (ELK1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100670835 (ELK1)
   05213 Endometrial cancer
    100670835 (ELK1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100670835 (ELK1)
   05161 Hepatitis B
    100670835 (ELK1)
   05163 Human cytomegalovirus infection
    100670835 (ELK1)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    100670835 (ELK1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:lav03000]
    100670835 (ELK1)
Transcription factors [BR:lav03000]
 Eukaryotic type
  Helix-turn-helix
   Tryptophan clusters Ets-type
    100670835 (ELK1)
SSDB
Motif
Pfam: Ets HSF_DNA-bind
Other DBs
NCBI-GeneID: 100670835
NCBI-ProteinID: XP_003418091
UniProt: G3TFB5
LinkDB
Position
Unknown
AA seq 431 aa
MDPSVTLWQFLLQLLREQSNGHIISWTSRDGGEFKLVDAEEVARLWGLRKNKTNMNYDKL
SRALRYYYDKNIIRKVSGQKFVYKFVSYPEVAGCSTEDCPPQPEVSVAASASAANVAPAA
VHVAPGDPVSGKPGTPKGTGMAGPSGLARSSRNEYMRSGLYSTFTIQSLQPQPPPQPQLP
PHPRPASVLPNTASAGAAAPPSGSSSTSPSPLEACLEAEDAGLPLQVILTPPEAPNPKSE
ELNVEPGLGRPLPPEVKVDGPKEELKATSREAGFVPEAIKVEAEILPAVAMETAAQGAGL
ASSAASSPEIAQPQKGRKPRDLELPLSPSLLGGTGPERTPGSGTGSGLQALGQALTPSLL
PTHTLTPVLLTPSSLPPSIHFWSTLSPIAPRSPAKLSFQFPSSGSAQVHIPSISVDGLST
PVVLSPGPQKP
NT seq 1296 nt   +upstreamnt  +downstreamnt
atggacccatctgtgacgctgtggcagtttctgctgcagctgctgagagagcaaagcaat
ggccatatcatctcctggacctcacgggatggtggtgagttcaagctggtagatgcagag
gaggtggcccggctgtggggactgcgcaagaacaagaccaacatgaattatgacaagctc
agccgggcattgcggtactactatgacaagaacatcatccgcaaggtgagcggccagaag
ttcgtttacaagtttgtgtcctaccctgaggtcgcagggtgctccactgaggactgccca
ccccagcctgaggtgtctgtcgccgcctctgcctccgcggcaaatgtggcccctgctgct
gtacacgttgcccccggggaccctgtctcagggaagccaggcacacccaaaggcacagga
atggcaggaccaagtggcttggcacgcagcagccggaacgagtatatgcgctcaggcctc
tattccaccttcaccatccagtccttgcagccacagcccccgcctcagcctcagctaccc
cctcatcctcggcctgcctcagtgcttcccaacaccgcctctgcaggagcagcagcaccc
ccctcagggagcagtagcaccagtccaagccctttggaggcttgcctggaggcagaggac
gctggcctgcctctgcaggttatcctgaccccgcctgaggccccaaacccgaaatcagaa
gagttgaacgtggagccggggttgggccggccactgcccccagaagttaaagtggacggg
cccaaagaagagctgaaagctacaagtagggaggcggggtttgtgccggaagctattaag
gttgaggcggaaattcttcccgcggtcgctatggagacagctgctcaaggggcgggccta
gcgtcatcggcagcttccagccctgagatcgcccagccacagaagggccggaagccccgg
gacttggagcttccgctcagcccaagcttgctgggtgggacggggccggaacggactccg
ggatcgggaactggctctggcttgcaggctctggggcaggcgctgacgccgtctttgcta
ccgacgcatacattgactccggtgctgctaacgcccagctcgctgccccccagcattcac
ttctggagcactctgagtcctattgcgccccgtagcccagccaagctctcattccagttt
ccatccagtggcagcgcccaggtgcacattccttccatcagcgtggacggcctttcgacc
cccgtggtgctctccccagggccccagaagccatga

DBGET integrated database retrieval system