KEGG   Loxodonta africana (African savanna elephant): 100670852
Entry
100670852         CDS       T04351                                 

Gene name
TNFAIP3
Definition
(RefSeq) tumor necrosis factor alpha-induced protein 3
  KO
K11859  tumor necrosis factor, alpha-induced protein 3 [EC:3.4.19.12]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04064  NF-kappa B signaling pathway
lav04217  Necroptosis
lav04621  NOD-like receptor signaling pathway
lav04657  IL-17 signaling pathway
lav04668  TNF signaling pathway
lav05162  Measles
lav05169  Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    100670852 (TNFAIP3)
   04668 TNF signaling pathway
    100670852 (TNFAIP3)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100670852 (TNFAIP3)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    100670852 (TNFAIP3)
   04657 IL-17 signaling pathway
    100670852 (TNFAIP3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05162 Measles
    100670852 (TNFAIP3)
   05169 Epstein-Barr virus infection
    100670852 (TNFAIP3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:lav01002]
    100670852 (TNFAIP3)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:lav04121]
    100670852 (TNFAIP3)
Enzymes [BR:lav01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100670852 (TNFAIP3)
Peptidases and inhibitors [BR:lav01002]
 Cysteine peptidases
  Family C64
   100670852 (TNFAIP3)
Ubiquitin system [BR:lav04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   OTU
    100670852 (TNFAIP3)
SSDB
Motif
Pfam: zf-A20 OTU
Other DBs
NCBI-GeneID: 100670852
NCBI-ProteinID: XP_003404055
UniProt: G3UHZ3
LinkDB
Position
Unknown
AA seq 790 aa
MAEQLLPLALYLSNMRKAVKIRERTPEDIFKPTNGIIHHFKTMHRYTLEMFRTCQFCPQF
REIIHKALIDRNTQASLESQRKLNWCREVRKLVALKTNGDGNCLMHAVSQYMWGVQDTDL
VLRKALFSALKETDTRNFKFRWQLESLKSQEFVETGLCYDTRNWNDEWDNLIKMASTDTP
GARVGFQYHSLEEIHIFVLCNILRRPVIVISDKMLRSLESGSNFAPVKVGGIYLPLHWPA
KECYRYPIVLGYDSQHFVPLVTLKDSGPEIRAVPLVNRDRGRFEDLKVHFLTDPENEMKE
KLLKEYLMVIEIPVQGWDVGTTHLINAAKLDEANLPKEINLVDDYFELVQHEYKKWQENN
QQGRREAHAPNPLEPSVPQLSLMDVKCETPNCPFFMSVNTQPLCHECSERWQKNKNKPPK
LNSKPGPEVLPGMALGAPRGEACEPLVWIPEEPAGGPHSAPPTAPSLFLFSETTAMKCRT
PGCPFTLNVQHNGFCERCHNARQLNTSRNVDSTRHLDPGKCRACLQDATRTFNGICSTCF
KRTTTETSSSLGPTVPSSCHQRSKSDPSQLIQSLSPHSCHRAGSEAQAGCLSQAARTPED
RTGTSKCRKAGCMYFGTPENKGFCTLCFIEYKENKYFVAALGKANSTAPRFQNAVPCLGR
ECGTLGSTMFEGYCQKCFIEAQNQRFHEAKRTEEQLRSSQRRDVLRTTQSSSRPKCARAS
CKNILACCSEELCMECQRRSQRTVPAPHRGEPAPDESPKQRCRAPACEHFGNAKCSGYCN
ECFQFKQMYG
NT seq 2373 nt   +upstreamnt  +downstreamnt
atggctgaacaactccttcccctggctttgtatttgagcaatatgcggaaagctgtgaag
ataagagagagaacgccagaagatatttttaaacctaccaatgggataattcatcatttt
aaaaccatgcaccgatataccctggaaatgttcagaacttgccagttttgtccacagttt
cgagagatcatccacaaagctctcatcgacagaaacacccaggcctccctggaaagccag
aggaagctcaactggtgtcgagaagtccggaagcttgtggctctaaaaaccaatggggat
gggaactgcctgatgcatgctgtttctcagtacatgtggggtgttcaggacacagacttg
gtcctgaggaaggcactcttcagcgctctcaaggaaactgacacgcgcaacttcaaattc
cgctggcaactggagtctcttaaatctcaggaatttgtggaaacggggctctgctatgac
actcggaactggaatgatgaatgggacaaccttatcaaaatggcatccacagatactcca
ggggcccgagttggatttcagtatcactcactggaagaaatacacatatttgtcctgtgt
aacattctcaggaggccagtcattgtcatttcagacaaaatgctgaggagtttggaatcc
ggttcaaattttgctcctgtgaaggtgggcggaatttacttgcctctccattggcctgct
aaggaatgctacagataccccatcgttcttggctacgacagccaacactttgtacccctg
gtgaccctcaaggacagcgggcctgaaatcagagccgttccacttgttaacagagaccga
ggacgattcgaagacttaaaagtccacttcttgacagatcctgaaaatgagatgaaggaa
aagctattaaaagagtacttgatggtgatagaaatccccgtccaaggctgggatgttggc
accacgcatttgattaatgctgcaaagttggatgaagctaatttaccaaaagaaataaat
ctggtagatgattactttgaactcgttcagcatgagtacaagaagtggcaggagaacaac
cagcagggacggagagaggcgcacgctccaaatcctctagaaccttccgtgccccagctt
tctctcatggacgtaaaatgtgaaacgcctaactgtcctttcttcatgtccgtgaatacc
cagcctttatgccacgaatgctccgagaggtggcaaaaaaataaaaataaacccccaaag
ctgaactctaagcctggccctgaggtgctccctggtatggctctcggggcccccaggggt
gaggcctgtgaacccttggtttggatccctgaggagccagctggggggcctcactcagcc
ccaccaactgcgcccagccttttcctattcagcgagaccactgctatgaagtgcaggacc
cccggctgcccgttcacactgaatgtgcagcacaatggattttgtgagcgttgccacaat
gcccggcaacttaacaccagccgtaatgtggactccacgaggcatttagatcctggtaag
tgcagagcttgcctccaggatgccacgaggacgtttaatggaatctgcagtacttgcttc
aaaaggactacgacagagacctcctctagcctcggccctactgtcccttcttcctgtcac
cagcggtccaagtcagatccttcccagctcatccagagtctctccccacattcttgccac
agagctggaagcgaggcccaggcaggttgcctctcccaggctgcacggactcctgaggac
agaacaggcacaagcaagtgcagaaaagctggctgcatgtattttgggactcccgaaaac
aaaggcttctgcacactgtgtttcatcgagtacaaagaaaacaaatactttgttgccgcc
ttggggaaagccaattccacagcccccaggttccagaatgcagttccctgcctggggaga
gaatgtggcaccctcggaagcaccatgttcgaaggatactgccagaagtgtttcattgaa
gctcagaatcagagatttcatgaagcaaaaaggactgaagagcaactgaggtcgagccag
cgccgagacgtgctacgtaccacccagagctcatctaggcccaagtgcgcccgggcctcc
tgcaagaacattctggcctgctgcagtgaggaactctgcatggagtgccagcgtcgcagc
cagcgaacggtcccagcaccccaccgtggggagcccgctcctgacgagtcccccaagcag
cgctgccgggcccctgcctgtgagcacttcggcaatgccaagtgcagtggctattgcaat
gagtgctttcagttcaagcagatgtacggctaa

DBGET integrated database retrieval system