KEGG   Loxodonta africana (African savanna elephant): 100670874
Entry
100670874         CDS       T04351                                 

Gene name
LIPE
Definition
(RefSeq) hormone-sensitive lipase
  KO
K07188  hormone-sensitive lipase [EC:3.1.1.79]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04024  cAMP signaling pathway
lav04152  AMPK signaling pathway
lav04371  Apelin signaling pathway
lav04714  Thermogenesis
lav04910  Insulin signaling pathway
lav04923  Regulation of lipolysis in adipocytes
lav04925  Aldosterone synthesis and secretion
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    100670874 (LIPE)
   04024 cAMP signaling pathway
    100670874 (LIPE)
   04152 AMPK signaling pathway
    100670874 (LIPE)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    100670874 (LIPE)
   04923 Regulation of lipolysis in adipocytes
    100670874 (LIPE)
   04925 Aldosterone synthesis and secretion
    100670874 (LIPE)
  09159 Environmental adaptation
   04714 Thermogenesis
    100670874 (LIPE)
Enzymes [BR:lav01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.79  hormone-sensitive lipase
     100670874 (LIPE)
SSDB
Motif
Pfam: HSL_N Abhydrolase_3 PRP4
Other DBs
NCBI-GeneID: 100670874
NCBI-ProteinID: XP_023399786
LinkDB
Position
Unknown
AA seq 911 aa
MKSGRTASLVREITVEPGSKSVSRPDWEPEPSQRLKNQQEPGPEKTLTMEPGSNKTQQEY
DIRQEPASQQRPLTQQESFAQHEAESQQETRAQQKSSLQQEPAPQQSPSTHPEATSQQEG
KESMTQQEPELRAGHVAQPEPGSVKPPLAQVAAESTSTTWPRPEPKQGPPAQVESTSQER
SEQEPDPTTQQTSLAQTAKSQQGSLTEWGFLAKLQEQSLQRSAAEWKTFFEWATDSDSES
DLGSPSETDSPVIREESGAQRRKLRFKRKPGYEVMSGYGGTSPNGKRTKSQNYSYYGDTA
SRLTHGMDLRTMTQSLVTLAEDNIAFFSSQGPGETARRLLGVFAGVREQALGLEPTLGRL
LGMAHLFDLDSETPANGYRSLVHTARCCLAHLLHKSRYVASNRRSIFFRSGHNLAELEAY
LAALTQLRALAYYAQRLLITSQPGRLFLEGDEGLTADFLREYVTLHKGCFYGRCLGFQFT
PTIRPFLQTISIGLVSFGEHYKRNETVSIDYSLAPEAPFPRALEECFYAYCWAVKHCALL
GSTGERICLAGDSAGGNLCFTVSLRAAAYGVRVPDGIMAAYPATMLQSSASPSRLLSLMD
PLLPLSVLSKCVSAYAGAETEDHSDSDQKALGMMGLVRRDTALLLRDLRMGASSWLNSFL
ELSGRKSHKTSVPIAEPVPVPMRRSVSEAALAQPEGPLGGDPVKSLTMQDLSLRSSSEAS
DTPKLSLSGETLGPSKPSDVNFLLGPEDVPEAAVAMDEVRTQDHCRGTSTAFPEGFHPRR
SSQGATRMPLDSSPIVKNPFMSPLLAPDYMLQSLPPVHIVACALDPMLDDSVMFARRLRS
LGQPVTLRVVEDLPHGFLSLAALCRETREAAALCVERIRLVLTPPGTSAPAPHGGLERQT
APATPPRTPPA
NT seq 2736 nt   +upstreamnt  +downstreamnt
atgaagtctgggagaacagcatctctcgtgagggaaataacagtggagccaggttcgaag
tcagtatctaggccagactgggaacctgagccatcccagagacttaaaaaccagcaagaa
cctgggccagaaaagacactcacaatggagccaggatctaataagactcagcaggaatat
gatattcggcaggagcctgcttcacagcaaagacccctcacccagcaggagtcatttgcc
caacatgaagctgaatcccagcaggaaactagagcccaacaaaaatcttctttgcagcag
gagcctgcaccacagcaatcgccttccactcatccggaagctacctcacagcaggaagga
aaagaatctatgacccaacaggaaccagaattgagagcaggacatgtagcccagccagaa
cctgggtcagtaaagccacctctagctcaagtggcagctgaatcaacatctacaacttgg
cccagaccagaacccaaacagggacctcctgcccaggttgaatctacatcccaagaaaga
tctgaacaagagccagaccctaccacccagcaaacctctctagcacagacagcgaaatcc
cagcagggatctttgactgagtggggatttctagcaaaactgcaggaacaatccctacag
cgatcggctgcagaatggaagacattttttgagtgggccacagattccgactcagaatca
gatctgggttctccatcagagacagattctccagtgataagggaagaatctggggcccaa
agaaggaagctgcgcttcaaaaggaaacctggatatgaagtgatgtcaggatatggtggg
acatcaccaaatgggaagagaaccaagagccagaattacagctactacggggacacagcc
tctcggctcacacacggcatggacctgcgcaccatgacacagtcgctggtgactctggca
gaggacaacattgctttcttctccagccagggccctggtgagacagcacggcggctattg
ggcgtctttgcaggtgtgcgggagcaggcactagggctggagccaaccctgggccgcctg
ctgggcatggcacacctcttcgacctggactcagagacacctgccaacgggtatcgtagc
cttgtgcacacagcccgctgctgcctggcgcaccttctccacaaatcacgttatgtggcc
tccaaccgccgcagcatcttcttccgctccggccacaacctggctgaactggaggcctac
ctggctgcccttactcagctccgtgctctggcctactacgcccagcgcctgctaatcacc
agccagcccgggagactcttcttagagggtgacgagggtctcacggctgatttcctgcgc
gagtatgttacgctgcacaagggctgcttctatggccgatgcctgggcttccagttcacg
cccaccatccggccattcctgcagaccatctctatcgggctggtgtccttcggggagcac
tacaagcgcaacgagacagtctccatcgactactccctggcccccgaggcccctttcccc
cgtgcacttgaggagtgcttctatgcctactgctgggccgtcaagcactgtgccctcctc
ggctcaacaggagagcggatatgccttgcaggagacagtgcaggtgggaatctctgcttc
actgtgtccctgcgggcagcggcctacggggtgcgagtgccagatggcatcatggcagcc
tacccagccaccatgctgcagtcgtcggcctcaccctcccgcctcttgagcctcatggac
cctctgctgcccctcagcgtgctctccaagtgtgtcagtgcctacgctggtgcagagaca
gaggaccactctgactcggaccagaaggcgctaggcatgatggggctggtgcggcgggac
acagccctgcttctccgagacctccgcatgggtgcctcctcatggctcaactccttcctg
gagctgagtgggcgcaagtcccacaagacctcggtgcccatagcagagccagtgccagtg
ccaatgcgacgcagcgtgtcggaggcagcactggcccagcctgagggccccctgggcggg
gacccagtcaagagcctgacgatgcaggacctaagcctgaggagcagctccgaggcatcg
gacacccccaagctgtcactgtcgggggagacacttggcccctccaagccctcagatgtc
aatttcttactgggcccggaggatgtgcctgaagcagctgtggccatggacgaagtgcgg
acccaggatcactgccgcggcactagcaccgctttccctgagggcttccacccgcggcgc
tccagccagggcgccacgaggatgcccctcgactcctcacctatcgtcaaaaaccccttc
atgtctccactgctggcacccgactacatgctacaaagcctgccgccagtgcacatcgtg
gcgtgcgcgctggaccccatgctggacgactcggtcatgttcgcgcggcggctgcgcagc
ctgggccagcccgtgacgctgcgcgtggtggaggacctgccgcacggcttcctgagcctg
gccgcgctgtgccgcgagacgcgggaagctgcggcgctgtgcgtggagcgcatccgcctc
gtcctcaccccgcctggcacctccgcgcccgcacctcacggcggcctggaacgccagacc
gcgcccgccacgccgccgcgcacgccaccggcctga

DBGET integrated database retrieval system