KEGG   Loxodonta africana (African savanna elephant): 100670957
Entry
100670957         CDS       T04351                                 

Gene name
NRG2
Definition
(RefSeq) LOW QUALITY PROTEIN: pro-neuregulin-2, membrane-bound isoform
  KO
K05456  neuregulin 2
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav01521  EGFR tyrosine kinase inhibitor resistance
lav04012  ErbB signaling pathway
lav05014  Amyotrophic lateral sclerosis
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100670957 (NRG2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    100670957 (NRG2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100670957 (NRG2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:lav04052]
    100670957 (NRG2)
Cytokines and growth factors [BR:lav04052]
 Growth factors
  Growth factors (RTK binding)
   100670957 (NRG2)
SSDB
Motif
Pfam: Neuregulin I-set Ig_3 ig Ig_2 C2-set_2 V-set Ig_6 EGF Neur_chan_memb EGF_2
Other DBs
NCBI-GeneID: 100670957
NCBI-ProteinID: XP_023405359
LinkDB
Position
Unknown
AA seq 632 aa
MPGVALTSATLTVLPCTPTATRPKLKKMKSQTGQVGEKQSLKCEAAAGNPQPSYRWFKDG
KELNRSRDIRIKYGNGRKNSRLQFNKVKVEDAGEYVCEAENILGKDTVRGRLHVNSVSTT
LSSWSGHARKCNETAKSYCVNGGVCYYIEGINQLSCKCPNGFFGQRCLEKLPLRLYMPDP
KQKAEELYQKRVLTITGICVALLVVGIVCVVAYCKTKKQRKQMHNHVRQNMCPAHQNRSL
ANGPSHPRLDPEEIQMADYMSKNVPATDHVIRRETETTFSGSHSCSPSHHCSTATPTSSH
RHESHTWTLERSESLTSDSQSGIMLSSVGTSKCNSPACVEARARRAAAYSLEEQRRAAVP
SYHDSIDSLRDSPHSERYVSALTTPARLSPVDFHYSLATQVPTFEITSPNSAHAVSLPPA
APITYRLAEQQPLLRHPAPPGPGPGPGADMQRSYDSYYYPAAGPGPRRGACALGGSLGSL
PASPFRIPEDDEYETTQECAPPPPPPPRPRARGASRRTSAGPRRWRRSRLNGLAAQRARA
ARDSLSLSSGSGGGSASASDDDADDADGALAAESTPFLGLRTAQDALRSDSPPLCPAADS
RTYYSLDSHSTRASSRHSRGPPPRGKQDSAPL
NT seq 1899 nt   +upstreamnt  +downstreamnt
atgcctggagttgctctcaccagtgccacgctcaccgtcctgccttgtacccccacagcc
acccggcctaagctgaagaagatgaaaagccagacgggacaggtgggtgaaaagcaatcg
ctgaagtgcgaggcagcagccggtaacccccagccctcctaccgctggttcaaggatggc
aaggagctcaaccgcagccgtgacattcgaatcaagtacggaaacggcagaaagaactca
cgactccagttcaacaaggtgaaggtggaggacgctggggagtatgtctgcgaggccgag
aacatcctgggcaaggacacagtgcggggccggctccacgtcaacagcgtgagcaccact
ctgtcatcctggtcggggcatgcccggaagtgcaacgagacagctaagtcctattgtgtc
aatggaggcgtctgctactacattgaaggcatcaaccagctctcctgcaaatgtccaaac
ggattcttcggacagagatgtttggagaaactgcctttgcgattgtacatgccagatcct
aagcaaaaagctgaggagttgtaccagaagcgggtcttgactatcactggcatctgcgtg
gctttgctggtcgtgggcatcgtctgcgtggtagcctactgcaagaccaaaaaacaacgg
aagcagatgcacaaccacgtccggcagaacatgtgcccagcccaccagaaccggagcttg
gccaatgggcccagccatccccggctggaccctgaggagatccagatggcagactatatg
tccaagaacgtgccggccacagaccatgtcatccggagggaaaccgagaccaccttctct
gggagccactcctgttctccttctcaccactgctccacagccacgcccacctccagccac
agacacgagagccacacgtggaccctggagcgttctgagagcctgacttctgactcccag
tcgggcatcatgctgtcatcagtaggcaccagtaagtgcaacagcccagcatgtgtggag
gcccgggcgcgacgggcagcagcctacagcctggaggaacagcgcagggcagctgtgcca
tcctaccatgactccatagactccctgcgtgactccccacacagcgagaggtacgtgtcg
gccctgaccacgcccgcgcgcctctctcccgtggacttccactactcgctggccacgcag
gtgccaacttttgagatcacgtcccccaactcggcgcacgccgtgtcgctgcctccggcc
gcgcccatcacctaccgcctggcggagcagcagccgctgctgcggcacccggcgccccca
ggccccggccccgggcccggcgcggatatgcagcgcagctacgacagctactactacccg
gcggcggggccgggcccgcgacgcggggcctgtgcgctcggcggcagcctgggcagcctg
cccgccagcccgttccgcatccccgaggacgacgagtacgagaccacgcaggagtgcgcg
cccccgccgccgccgccgccgcggccgcgcgcgcgcggcgcgtcccgcaggacgtcggcg
gggccccggcgctggcgccgctctcgcctcaacgggttggcggcgcagcgcgcacgcgcg
gcgcgggactcgctgtcgctgagcagcggctcgggcggcggctcggcttcggcctcggac
gacgacgcggacgatgcggacggggcgctggcggccgagagcacgcctttcctcgggctg
cgcacggcgcaagacgcgctgcgctcggactcgccgccgctctgcccggcggccgacagc
aggacttactactccctggacagccacagcacgcgggccagcagcagacacagccgcggg
ccgccgccgcggggcaagcaggactcggcgcccctctag

DBGET integrated database retrieval system