KEGG   Loxodonta africana (African savanna elephant): 100670988
Entry
100670988         CDS       T04351                                 

Gene name
CTNNB1
Definition
(RefSeq) LOW QUALITY PROTEIN: catenin beta-1
  KO
K02105  catenin beta 1
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04015  Rap1 signaling pathway
lav04310  Wnt signaling pathway
lav04390  Hippo signaling pathway
lav04510  Focal adhesion
lav04520  Adherens junction
lav04550  Signaling pathways regulating pluripotency of stem cells
lav04670  Leukocyte transendothelial migration
lav04916  Melanogenesis
lav04919  Thyroid hormone signaling pathway
lav04934  Cushing syndrome
lav05010  Alzheimer disease
lav05022  Pathways of neurodegeneration - multiple diseases
lav05100  Bacterial invasion of epithelial cells
lav05132  Salmonella infection
lav05160  Hepatitis C
lav05163  Human cytomegalovirus infection
lav05165  Human papillomavirus infection
lav05167  Kaposi sarcoma-associated herpesvirus infection
lav05200  Pathways in cancer
lav05205  Proteoglycans in cancer
lav05210  Colorectal cancer
lav05213  Endometrial cancer
lav05215  Prostate cancer
lav05216  Thyroid cancer
lav05217  Basal cell carcinoma
lav05224  Breast cancer
lav05225  Hepatocellular carcinoma
lav05226  Gastric cancer
lav05412  Arrhythmogenic right ventricular cardiomyopathy
lav05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100670988 (CTNNB1)
   04310 Wnt signaling pathway
    100670988 (CTNNB1)
   04390 Hippo signaling pathway
    100670988 (CTNNB1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100670988 (CTNNB1)
   04520 Adherens junction
    100670988 (CTNNB1)
   04550 Signaling pathways regulating pluripotency of stem cells
    100670988 (CTNNB1)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    100670988 (CTNNB1)
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    100670988 (CTNNB1)
   04916 Melanogenesis
    100670988 (CTNNB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100670988 (CTNNB1)
   05205 Proteoglycans in cancer
    100670988 (CTNNB1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100670988 (CTNNB1)
   05225 Hepatocellular carcinoma
    100670988 (CTNNB1)
   05226 Gastric cancer
    100670988 (CTNNB1)
   05216 Thyroid cancer
    100670988 (CTNNB1)
   05217 Basal cell carcinoma
    100670988 (CTNNB1)
   05215 Prostate cancer
    100670988 (CTNNB1)
   05213 Endometrial cancer
    100670988 (CTNNB1)
   05224 Breast cancer
    100670988 (CTNNB1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100670988 (CTNNB1)
   05022 Pathways of neurodegeneration - multiple diseases
    100670988 (CTNNB1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100670988 (CTNNB1)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    100670988 (CTNNB1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100670988 (CTNNB1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100670988 (CTNNB1)
   05100 Bacterial invasion of epithelial cells
    100670988 (CTNNB1)
  09172 Infectious disease: viral
   05160 Hepatitis C
    100670988 (CTNNB1)
   05163 Human cytomegalovirus infection
    100670988 (CTNNB1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100670988 (CTNNB1)
   05165 Human papillomavirus infection
    100670988 (CTNNB1)
SSDB
Motif
Pfam: Arm Cnd1 Adaptin_N HEAT_2 HEAT_EZ KAP Atx10homo_assoc Arm_2 Queuosine_synth
Other DBs
NCBI-GeneID: 100670988
NCBI-ProteinID: XP_010588212
LinkDB
Position
Unknown
AA seq 781 aa
MATQADLMELDMAMEPDRKAAVSHWQQQSYLDSGIHSGATTTAPSLSGKGNPEEEDVDTT
QVLYEWEQGFSQSFTQEQVADIDGQYAMTRAQRVRAAMFPETLDEGMQIPSTQFDAAHPT
NVQRLAEPSQMLKHAVVNLINYQDDAELATRAIPELTKLLNDEDQVVVNKAAVMVHQLSK
KEASRHAIMRSPQMVSAIVRTMQNTNDVETARCTAGTLHNLSHHREGLLAIFKSGGIPAL
VKMLGSPVDSVLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDC
LQILAYGNQESKLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVEA
GGMQALGLHLTDPSQRLVQNCLWTLRNLSDAATKQEGMEGLLGTLVQLLGSDDINVVTCA
AGILSNLTCNNYKNKMMVCQVGGIEALVRTVLRAGDREDITEPAICALRHLTSRHQEAEM
AQNAVRLHYGLPVVVKLLHPPSHWPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLL
VRAHQDTQRRTSMGGTQQQFVEGVRMEEIVEGCTGALHILARDVHNRIVIRGLNTIPLFV
QLLYSPIENIQRVAAGVLCELAQDKEAAEAIEAEGATAPLTELLHSRNEGVATYAAAVLF
RMSEDKPQDYKKRLSVELTSSLFRTEPMAWNETADLGLDIGAQGEPLGYRQDDPSYRSFH
SGGYGQDALGMDPMMEHEMGGHHPGADYPVDGLPDLGHAQDLMDGLPPGDSNQLAWFDTD
L
NT seq 2346 nt   +upstreamnt  +downstreamnt
atggctacacaagctgatttgatggagttggacatggccatggagccagacagaaaagct
gctgttagtcactggcagcagcagtcttacctggactctggaatccattctggtgccact
accacggctccttctctgagtggtaaaggcaatcctgaggaagaggatgtggataccacc
caagtcctgtacgagtgggaacaggggttttctcagtccttcactcaagaacaagtagct
gatattgatggacagtatgcgatgacgcgagctcagagggtacgagctgctatgttccca
gagacgttagatgagggtatgcagatcccatctacacaatttgatgctgctcatcccact
aatgtccagcgtttggctgaaccatcacagatgctgaaacatgcagttgtaaatttgatt
aactatcaagatgatgcagaacttgccacacgtgcaatcccagagttgacaaaattgcta
aatgacgaggaccaggtggtggttaataaggctgcagttatggtccatcagctttctaaa
aaggaagcttccagacacgccatcatgcgttctcctcagatggtgtctgctattgtacgt
accatgcagaatacaaacgatgtggaaacggctcggtgtactgctgggaccttgcacaac
ctctcccatcaccgtgagggcttgttggccatctttaaatctggaggcattcctgccctg
gtgaagatgcttggttcaccagtggattctgtattgttttatgccattacaactctccac
aaccttttattacatcaagaaggagctaaaatggcagtgcgtttagctggtgggctgcag
aaaatggttgctttgctcaacaaaacaaatgttaagttcttggctattacaacagactgc
cttcagattttggcttatggcaatcaagaaagcaagctgatcattctggctagcggtgga
ccccaagctttagtaaatataatgaggacctatacttatgagaaactgctgtggaccaca
agcagagtattgaaggtgctgtctgtctgctctagtaataagccggctattgtagaagct
ggtggaatgcaagctttaggacttcacctgacagatccaagtcaacgtcttgttcagaac
tgtctttggactcttaggaatctttcagatgctgcaactaaacaggaaggaatggaaggt
cttcttgggactctggttcagcttctgggttcagacgatataaatgtggtcacctgtgca
gctgggattctttctaacctcacttgcaataattataagaacaagatgatggtatgccaa
gtgggaggtattgaggctctcgtgcgtactgtccttcgtgctggtgacagagaggacatc
actgagcctgccatctgtgctcttcgtcatctgaccagccgacaccaggaagcagagatg
gcccagaatgctgttcgccttcactatggactaccagttgtggttaaactcctacatccg
ccatcccattggcctctgataaaggctactgttggattgattcgaaaccttgccctttgt
ccagcaaatcacgcacctttgcgtgagcagggtgccattccacgactagttcagttgctg
gttcgagcacatcaggacacccagcgccgcacgtccatgggtggaacacagcagcagttc
gtggagggagtccgcatggaagaaatagttgaaggttgtactggagcccttcacatcctg
gctcgggatgttcacaaccgaattgtaatcagaggactaaataccattccgttgtttgtg
cagctactctattctcccattgaaaatatccaaagagtagctgcaggggtcctctgtgaa
ctagctcaggacaaggaggctgcagaagctattgaagctgagggagccacagctcctctg
acagaattgcttcactctaggaatgaaggtgtggcgacatatgcagctgctgttttgttc
cgaatgtctgaggacaagccacaggattacaagaaacggctttcagttgagctgaccagt
tctctcttcagaacggagccgatggcttggaatgagactgctgaccttggacttgatatt
ggtgcccagggagagccccttggatatcgccaggatgatcccagctatcgttctttccac
tctggtggatatggccaggatgccttgggtatggaccccatgatggagcatgaaatgggt
ggccaccaccctggtgctgactatccagttgatgggctgccagatctggggcatgcccaa
gacctcatggatgggctgcctccaggtgacagcaatcagctggcctggtttgatactgac
ctgtaa

DBGET integrated database retrieval system